[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56712.1


[Show Plain Result]

## Summary of Sequence Search
   1::280
  15::266  PF00248 0.0% 38.2716049382716  Aldo/keto reductase family 
   1::280


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
PF00248         --------------lglGtwslgsdeisedealellraaleaGinlfDtAevYgkgkseellgealkksr


                         -         -         *         -         -         -         -:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
PF00248         vkreeviiatKvdgriapqseglsrenirksleesLkrlgtdylDllllHrpdpslp.........ieev


                         +         -         -         -         -         *         -:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
PF00248         lealeelkkeGkiryiGvSnfsveilekalkkkkvkivvvqveynllrrlaeegllelcaekgvgiiays


                         -         -         -         +         -         -         -:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
PF00248         plggGlltgkyeseedkedkeprkdknqealeelselakehgvsiaqlalryalsr--------------