[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56832.1


[Show Plain Result]

## Summary of Sequence Search
   1::328
 291::318  PF12368 0.0% 67.8571428571429  Protein of unknown function (DUF3650) 
 121::215  PF00581 0.0% 33.6842105263158  Rhodanese-like domain 
   1::328


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
PF12368         ----------------------------------------------------------------------
PF00581         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
PF12368         ----------------------------------------------------------------------
PF00581         --------------------------------------------------sakelkellekekvvllDvR


                         +         -         -         -         -         *         -:210
query           NDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
PF12368         ----------------------------------------------------------------------
PF00581         speeyekghIpgAvnvpldslypkrdlpfkdklaeeleesgkkldkkktvvvycssgnrsggaaalllal


                         -         -         -         +         -         -         -:280
query           GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
PF12368         ----------------------------------------------------------------------
PF00581         ilkel-----------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV----------------------
PF12368         ----------ECRvHPRNRYVkeHnLSeEEvaeRLeai--------------------------------
PF00581         ----------------------------------------------------------------------