[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for spne4:ACF56852.1


[Show Plain Result]

## Summary of Sequence Search
   1::156
   5::66   PF01316 0.0% 48.3870967741936  Arginine repressor, DNA binding domain 
  80::148  PF02863 0.0% 31.8840579710145  Arginine repressor, C-terminal domain 
   1::156


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSIS
PF01316         ----eqrqelikeilkeekistQeelvaeLkeeGinvtQatvSRdLkelgavkvraengearYvlp----
PF02863         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
PF01316         ----------------------------------------------------------------------
PF02863         ---------lkelvvsvdrnenlvvikTlpGnAqlvaslldslkleeIlGtiAGdDtilvicrseeaaee


                         +         -         -         -         -         *         -:210
query           CFEELKKFAPPFFFEE------------------------------------------------------
PF01316         ----------------------------------------------------------------------
PF02863         laekikkl--------------------------------------------------------------