[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF54777.1


[Show Plain Result]

## Summary of Sequence Search
   1::605
 433::603  3.4e-05 23.8% 0051447 00514471 1/1   hydrolase                               
 396::596  4.4e-05 19.1% 0046880 00468801 1/1   hydrolase                               
 429::599  0.00015 23.0% 0047668 00476681 1/1   hydrolase                               
   1::605


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIKWFSLVRITGLLLVLLYHFFQTIFPGGFFGVDVFFTFSGFLITALLIEEFSKNHEIDLIGFFRRRFY
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RIVPPVVLMVLVTMPFTFLVRQDYVAGIGGQIASVLGFMTNFYELLTGGSYESQFIPHLFVHNWSLAVEV
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HYYILWGLAVWFLSKQAKSNGQLKGMVFLLSAVAFLISFFSMFIGSFLVTSYSSVYFSSLTHVYPFFLGS
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MLATIVGVRQTTSLVKQLDKIWDLRKTLVVFGGGFGFLVLLTFFVKFTYLFAYLIGFLLASLAALAMILA
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ARVLHEKTHHIQEPKIISFLADTSYAVYLFHWPFYIIFSQLTSNLLAVLLTLICSYGFASLSFYVLEPWI
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ----------------------------------------------------------------------
00476681   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AGKNTPIVQTLRPLPYIHAILAAGTGILTIIVCTVTLLAPQVGAFETDLTVNGLKQAATNIGQTKVMAER
00514471   1/1  ----------------------------------------------------------------------
00468801   1/1  ---------------------------------------------lllallllpvllllgllvwlsllal
00476681   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADANSLGIADGTMLIGDSVALRANTALQTALPGAQINAQVSVTTKTANEIMLNNSQNKFLPKTVVIATGV
00514471   1/1  ------------plrilllGDSitagygasgpgggwpallaellaarfgrgvtvinlGisGdttadllar
00468801   1/1  alalakekplrilflGDSitagwglsggwrellaglevinlGisGdttadllarleedvldnlkpdlvvl
00476681   1/1  --------plrilllGDSitagyglspgggwpallaealgagvtvinlgisGdttadgla.rldalllal


                         *         -         -         -         -         +         -:560
query           NNPENYKDDWDSIVKNLPKGHHMILVTPYEGDKTKETYAIVEKAAAYMRELAEKTPYITIADWNQVAKEH
00514471   1/1  ldrlllalkpdlvvillGtNDllllrgvsleefaanlralidrlrapgakvvlvtpppvgelpnrlnerl
00468801   1/1  mlGtNDlglspeeiaenlralieliraklPgakilllgllpvgerpnylnerikelnellkelakelpgv
00476681   1/1  kpdlviillGtNDllrgvspeefranlralierlrapgakvvlvtpppp..pnylndylaalndalrela


                         -         -         -         *         -         -         -:630
query           PEIWAGTDQVHFGSESSTIEAGAKLYADTIATALQTAQDKPVKSK-------------------------
00514471   1/1  aaynaalrelaael.gvpfvdlysalldlaglpelllpDglHp---------------------------
00468801   1/1  tfvdlydllldedgtlpellt.aDglHpna......----------------------------------
00476681   1/1  kel.gvplvdlfallldldgelllaDglHpnaa......-------------------------------