[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF54875.1


[Show Plain Result]

## Summary of Sequence Search
   1::738
 325::667 3.2e-104 42.0% 0051664 00516641 1/1   s)glycosidases                          
 319::631  1.1e-79 39.9% 0049502 00495021 1/1   s)glycosidases                          
 322::629  3.3e-76 41.9% 0049842 00498421 1/1   s)glycosidases                          
 320::631  2.4e-67 39.3% 0047875 00478751 1/1   s)glycosidases                          
 323::645  4.7e-62 42.5% 0049099 00490991 1/1   s)glycosidases                          
 306::639    9e-42 26.9% 0052585 00525851 1/1   s)glycosidases                          
 398::567  0.00015 23.3% 0051733 00517331 1/1   s)glycosidases                          
 392::486  0.00034 25.8% 0046559 00465591 1/1   s)glycosidases                          
   1::738


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVSFSEEFEDIQQ
00516641   1/1  ----------------------------------------------------------------------
00495021   1/1  ----------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  ----------------------------------------------------------------------
00490991   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQDFELEKGKNRLNSLPSTFDDIGQCAETLTIILTD
00516641   1/1  ----------------------------------------------------------------------
00495021   1/1  ----------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  ----------------------------------------------------------------------
00490991   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAMSLQLDLPDSQYDFIQFSGAWLRERQLYRTS
00516641   1/1  ----------------------------------------------------------------------
00495021   1/1  ----------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  ----------------------------------------------------------------------
00490991   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LRPGIQAIDSLRYSSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVE
00516641   1/1  ----------------------------------------------------------------------
00495021   1/1  ----------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  ----------------------------------------------------------------------
00490991   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKIL
00516641   1/1  --------------------------------------------glgkpppvlwnsWeayyfdvdeekvl
00495021   1/1  --------------------------------------llaldpglaltppmgwnsWnayyfdideekil
00498421   1/1  -----------------------------------------ldnglaktppmgwnsWnafyfdineekil
00478751   1/1  ---------------------------------------Lpnglar...tPplgwnsWnafyfdvdydel
00490991   1/1  ------------------------------------------ldnglartPpmgwnsWnafyfdtdlgvd
00525851   1/1  -------------------------edvlkqytlltgkpplpprwalg....iyqsw.rsfydgdlegil
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
00516641   1/1  eladeaaelgvevfvlDdgWfg.......glGdwefdpekFPdglk.ladkikelGlkfglWiePfmvnp
00495021   1/1  kladalvengladlgyeyvviDdgWfgkrrdd...lgdlvpdpekFPnGlkaladyihalGlkfGlwvep
00498421   1/1  eladaaaenglkdlgyeyvviDdgWfgkrrdd...lgdwvpdpekFPnGlkaladyihskGlkfglwlep
00478751   1/1  lnlliseekildladalvdngaadlgyeyfviDdgWqglrrd...glgdwefdpekfPnGlkalvdyihs
00490991   1/1  fksgineetileladalaengaadlgyeyfviDdgWqglrrdd...lgdwepdpekFPdglkaladylhe
00525851   1/1  ekldylkelGipldaiwldpiwe.....dgydvgdytvdperfg.dfkalvdelharGikvilwvdn.ht
00517331   1/1  -----------------------------------------------lvdaaherGikvilDvVpNHtsp
00465591   1/1  -----------------------------------------pddlkalvdaahkrGikvilDvVpNHtsd


                         -         -         +         -         -         -         -:490
query           DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSI
00516641   1/1  dsdlfrehpdwllkrdggpvllwwwsgrgqyvLDftnpevrdwlldllkrll.ewgvdyfKlDfnealal
00495021   1/1  gmv..............................ldlgnpgvldyl.ellakllaewgvdylKlDanralt
00498421   1/1  gi.............................ytldlsnpgvldyleedak.tlaewgvdylKvDfnral.
00478751   1/1  lGlkvglWlapgivg.............................ldl.npeyvldyy.eqlakllaewgv
00490991   1/1  kGlkfglWlepggvt..............................dltnpevldyl.eqlakllaewGvd
00525851   1/1  spdspwflehldpdwfvwrpdggqyylhlwpgdqpdldftnpevreylldvlrfwl.eygvDgfrlDave
00517331   1/1  dspwfkehldwyvwfdgpgyfhsedpisdweddtgvgnyylhlfllglpdlnyenpevreelldvllywl
00465591   1/1  dhpwfkefpgwdyylwddp...wgglpdllnyenpevreylldvlrywldeygvDGfRlDaakhll----


                         *         -         -         -         -         +         -:560
query           ELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQ
00516641   1/1  pgvpllgge....yverytlgvyellerl...gpdvliesCsspllpslglvgggRidldilqrfprvwt
00495021   1/1  lpgdptlsgvldplaltdllvnlvaklgdllevrqgeltaryvlayyallkalratgpdilfslca.ggg
00498421   1/1  ................vqltlelyrlllealaktgrpiilscssgggrfpygwlryyanlwRissDitda
00478751   1/1  dylKlDfcnrlltegg..................gryellraaleatprvilescswgglrfllginada
00490991   1/1  yfKlDfne................eglleyvlglyellarllnaygrliiescsggggrldlgvl...pg
00525851   1/1  plpldfglmggllgafvhnlygllylralydalrellpgkrpflltrsgnhgsqry........aslwtg
00517331   1/1  eeygvdGfRlDaakhl........pveflrelrdav..dvflvaEvwd.gdpevlagylngldavfnfpl
00465591   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           HGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYR
00516641   1/1  sdntdalerlaiqaglslflpgflfwndpigghvgavpnhltge.lyirwrqlvallghmglsgddlwll
00495021   1/1  rsdwgwlaglgnswRissDitdawerlkiilgtsltlplyagpghlnDpdmlivgnggltldetrlhfrl
00498421   1/1  werlkiqigtslvlpllagpghwndpdmlivgnggltldetrlhfalwaalggpllisddlrelseeel-
00478751   1/1  gwlqylgnlwRisdDitdawerlliqlgaslaypdllmgyahpgllpdhdmlrlgnlgltldearfhfal
00490991   1/1  lwtsdysd.lwRisdDigpsw...psvlgihvaa..narnalllslagrgfwadpd..mlelgnggltae
00525851   1/1  Dntsawdrlklaiallltlpgsgipyygs....digGftggpd...........................
00517331   1/1  rdallda---------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SLFQYGDFYRINSPFSCDSASWQVVSKDKCQSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFF
00516641   1/1  deeeveilkkvialykrlrpylytgdpirrplwlspp---------------------------------
00495021   1/1  w---------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  w---------------------------------------------------------------------
00490991   1/1  eyrrhaalwalsg..-------------------------------------------------------
00525851   1/1  .......pe-------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           YGDELMNAGIKVSLSNLALCVPEYLTKLFVIEEVVCKY--------------------------------
00516641   1/1  ----------------------------------------------------------------------
00495021   1/1  ----------------------------------------------------------------------
00498421   1/1  ----------------------------------------------------------------------
00478751   1/1  ----------------------------------------------------------------------
00490991   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------