[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55041.1


[Show Plain Result]

## Summary of Sequence Search
   1::202
  25::193  1.8e-35 39.0% 0051126 00511261 1/1   lasmic binding protein-like II          
  29::193  2.8e-33 36.2% 0051127 00511271 1/1   lasmic binding protein-like II          
  29::193  2.6e-29 36.9% 0048393 00483931 1/1   lasmic binding protein-like II          
  27::193  1.2e-28 35.8% 0042407 00424071 1/1   lasmic binding protein-like II          
  27::193  2.1e-26 32.7% 0042594 00425941 1/1   lasmic binding protein-like II          
  28::194    4e-25 31.7% 0051197 00511971 1/1   lasmic binding protein-like II          
  30::194  7.5e-25 31.0% 0046289 00462891 1/1   lasmic binding protein-like II          
  27::202  7.3e-23 31.5% 0045745 00457451 1/1   lasmic binding protein-like II          
  26::194  9.5e-23 31.1% 0043543 00435431 1/1   lasmic binding protein-like II          
  28::194  3.8e-22 32.1% 0051251 00512511 1/1   lasmic binding protein-like II          
  28::193  6.3e-15 27.6% 0049726 00497261 1/1   lasmic binding protein-like II          
  26::194  1.4e-13 30.7% 0046627 00466271 1/1   lasmic binding protein-like II          
  29::162  2.2e-13 30.9% 0045817 00458171 1/1   lasmic binding protein-like II          
  28::183  1.1e-09 29.3% 0045793 00457931 1/1   lasmic binding protein-like II          
  10::194  2.1e-08 25.5% 0037070 00370701 1/1   lasmic binding protein-like II          
  24::193  3.5e-05 21.5% 0045538 00455381 1/1   lasmic binding protein-like II          
  20::191  3.9e-05 23.1% 0048733 00487331 1/1   lasmic binding protein-like II          
  28::195   0.0008 19.6% 0044496 00444961 1/1   lasmic binding protein-like II          
   1::202


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKL
00511261   1/1  ------------------------aaegeLtvytagsydllkalldaFeketgikvevvfggsgellakl
00511271   1/1  ----------------------------eLtvysagsydllkalleaFeketgikvevvtggsgellakl
00483931   1/1  ----------------------------eLtvysaggyealeelakaFeketgikVevvtggsgellakl
00424071   1/1  --------------------------egtLtvyswggy.llealikaFeketgikvkyvtggsgeellak
00425941   1/1  --------------------------egeltvytwgslylleellkaFeketgikVevvtggsg.llakl
00511971   1/1  ---------------------------GtltvyswggyealeelakaFeketgikvevvfggsgdllakl
00462891   1/1  -----------------------------eltvytwggydaleelakaFeketgikvevvtggsgellak
00457451   1/1  --------------------------ektLtvyswggy.llealikaFeketgikVeyvtfgsneellak
00435431   1/1  -------------------------aagtLtvysasgltdalkelakaFekkykeetgtgikveyvyggs
00512511   1/1  ---------------------------gtltvytwggydaleelakaFeketgikvevvtggsg.llakl
00497261   1/1  ---------------------------seltvagssslapllealaeaFekeypgikvnvvaggsgalla
00466271   1/1  -------------------------laggtltvytwgggyeaealeelikaFekenpgikvevvtlgsdd
00458171   1/1  ----------------------------eltvaaaasltdaleelaeaFeketgikVvvsfggsgalaaq
00457931   1/1  ---------------------------eeltvaaaaslkdaleelaaaFeketgvkvevsfggsgalarq
00370701   1/1  ---------aCg.............agvtltvwtwg.dgadlaalkelikeFeketpgikvkvvtvgdye
00455381   1/1  -----------------------aaaevtltvwt.wggyiaealkelikkFekepgikVkvvpyddyeek
00487331   1/1  -------------------laaagaaaagtltiagsstvapllealaeafekanpgvkvnvesgGsgagl
00444961   1/1  ---------------------------vtltvwhwlgggegaalkelvaaFekehpdikVkvvtvpyddl


                         -         -         *         -         -         -         -:140
query           ESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMN
00511261   1/1  laegggspaDvvlsadadllarlaeagllapldspnldnippelrdgdgywvplalgalvlvynkdllke
00511271   1/1  laegggspaDvvlsadadllarlaeagllapldspnldnlppelrdgdgywvplavgalvlvynkdllke
00483931   1/1  kaegggapaDvvlsadadllarlakaGllapldspnldnlppnlrdpdgklygvplavgtlvlvynkdll
00424071   1/1  llae.ggsgaDvvvvdayflarlakaGllepldpsklpnldnlppglrdpltddgkgygvpytvgttvla
00425941   1/1  laegggsgaDvvlvadadllaklakagllepldssklpnllpaalddgngygvpyavgtlvlvynkdllk
00511971   1/1  laalaagnpDvvlsadadllaklaeaGllapldddflpalldaatvdgklygvPyavgtlvlvynkdl..
00462891   1/1  llaeaggsppDvvlsadagllarlakaGllaplddllldpnlddllpalldld..gvpyavgtlvlvynk
00457451   1/1  lla..ggsgpDvvvldadflarlaeaGllepldksklpnldnlppalldalgttddgklygvpytwgttg
00435431   1/1  gallakll..agaq.aDvvasadagdldrlakagllqpldpkklp...........yavplatgtlvliv
00512511   1/1  laeaagsgpDvvlsadagllaklaeaGllaplddldflpalldaatdpdgklyglpygtlvlvynkdlkf
00497261   1/1  qllag....paDvvlssdpllleelaa...........glvavpvaydglvvvvppgnpvlvlnkdqlak
00466271   1/1  llaklallaalaagngqpDvvv.ldagdlaqlaeaGllaplddlladklpnlddllpalldlaatvdGkl
00458171   1/1  ieaga...paDvflsadakaldklvkegllvp.................gsrvplalgalvlvvnkgnpv
00457931   1/1  ieegap...aDvflsadaalldklvekglvvp.................gsrvtlalnrlvlvvpkgnpk
00370701   1/1  eklltalaagng.pDvvvldadflaqlakaGllaplddllklpnlddflpalldaatvdGklygvPyavg
00455381   1/1  latalaggna.pDvvqldgdwlgqlakagllaplddllkdl.ddflpalldaatydgklygvPyavgtlg
00487331   1/1  kalla............gtaDiaassrplkdeelaaag..........glveipvaldgivvvvnkdnpv
00444961   1/1  ltklltalaagna.pDvvvvldgdwlgqlaaagllaplddll.ldlddflpaaldavtydgklygvPfdv


                         +         -         -         -         -         *         -:210
query           IEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVK--------
00511261   1/1  aglPkswddLldpelkgkialadp..sgtglallaallqalGe...ekalell-----------------
00511271   1/1  aglPkswadLldpklkgkialadp..sgtglalllallgllge...ekalell-----------------
00483931   1/1  keaglPkswedLldpklkgkialadp..sssgtgllaallaalgg...dkale-----------------
00424071   1/1  ynkdllkkagpkswddLldpklkgkvalpdpassglgaallaaglslnglnpe-----------------
00425941   1/1  eaglPkswddLldpklkgkvalldp..tsgyglallaaglslyged..kalel-----------------
00511971   1/1  gldpkdpktwddlldpklkgkialgdp.gsglggallaallaalg...avkale----------------
00462891   1/1  dlfkkaglPktwddLldpklkgkvalg.p.ssgtgglallallaalgg...vka----------------
00457451   1/1  laynkdlfkeagldpeppkswddLldpklkgklgvygialldppssg.....lgaallalgg--------
00435431   1/1  nkdnpkk..ikswddLlkpgvk..vvlpdpktsgtgrlallallaaglskdkgd----------------
00512511   1/1  kk..pk.wddLldpklkGkialadp.tsglglallaallaang...avkalefl----------------
00497261   1/1  iflgkitswkdLakpdlkikvvlrdp..gsgtrglflaal.lag...ldlale-----------------
00466271   1/1  ygvPytvgtlvlyynkdllkkaGlpepPktwddlldaakklkekdglggpgvkg----------------
00458171   1/1  ...iksladLakpnlk.rvaia------------------------------------------------
00457931   1/1  d..ilsledllkpllkgkgvriaiadpklvpygry.alealek---------------------------
00370701   1/1  ttglyYnkdlfkk.pPktwdelleaakklkeklkgkvgladpggdw....vfla----------------
00455381   1/1  lyYnkdlfkk.pPktwdelleaakklkakgkyglalggddgw...lllallls-----------------
00487331   1/1  aglkLtveqladiflgkitnWsdvdiaalnpglglpdlpivvvgrsdgsgt-------------------
00444961   1/1  stlvlyYnkdlfkk.pPkTwdelleaakklkakgkygyglgg..wdlvylflall---------------