[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55075.1


[Show Plain Result]

## Summary of Sequence Search
   1::145
   5::137  2.7e-32 37.8% 0045032 00450321 1/1   ed helix" DNA-binding domain            
   2::141  6.4e-29 33.3% 0051337 00513371 1/1   ed helix" DNA-binding domain            
   4::69     7e-05 24.6% 0039384 00393841 1/1   ed helix" DNA-binding domain            
   1::145


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDL
00450321   1/1  ----kkldyalrillylal...depvsseeiAerlgvspstlrkilslLkkaglvesvrGaGgyvlardp
00513371   1/1  -rlstktdyalrallylalhgge.pvtseeiAerlgispsylrkilakLrkaglvesvrGkGGyrLarpp
00393841   1/1  ---llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrgg.gyrlagd-


                         -         -         *         -         -         -         -:140
query           KDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVADAE
00450321   1/1  eeitlldvvrave...gplllvecledpnplcpvglailcvlrevlleaeqallevldsitladlvd---
00513371   1/1  eeitlldvvravellgpl.alvecledllgdclvgdaincvlrdllleaeeallevLdsitLadlledle
00393841   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SQMKD-----------------------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------
00513371   1/1  e---------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------