[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55106.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
   1::297  9.9e-93 41.4% 0041699 00416991 1/1   like peptide ligases, catalytic domain  
   1::311  1.3e-72 39.1% 0052866 00528661 1/1   like peptide ligases, catalytic domain  
  28::295  1.5e-33 31.3% 0042137 00421371 1/1   like peptide ligases, catalytic domain  
  38::296  9.8e-33 31.5% 0038085 00380851 1/1   like peptide ligases, catalytic domain  
  35::273  6.3e-24 25.7% 0045483 00454831 1/1   like peptide ligases, catalytic domain  
 298::428  5.2e-23 34.4% 0041698 00416981 1/1   like peptide ligases, peptide-binding d 
 296::430  3.9e-21 32.6% 0052865 00528651 1/1   like peptide ligases, peptide-binding d 
 296::428  7.8e-15 29.7% 0046486 00464861 1/1   like peptide ligases, peptide-binding d 
 295::435    9e-14 20.1% 0039392 00393921 1/1   like peptide ligases, peptide-binding d 
  35::102  5.7e-05 26.5% 0046487 00464871 1/1   like peptide ligases, catalytic domain  
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIGGTNGKGSTIAFLKKMLEKLGLRVGV
00416991   1/1  lllmtleealdyllsllplgaidlglervrrllellglpqnalpvihvaGTnGKGstcaflesilraagl
00528661   1/1  vvlspalplllplpviavelglealsrlalllgnplkklpviaVtGTnGKttTtallasileaaglkvgl
00421371   1/1  ---------------------------rlellarllldlpviavtGTnGKTTttallaaileaaglkvga
00380851   1/1  -------------------------------------klpviavTGTnGKTTttsllaaileaaglvval
00454831   1/1  ----------------------------------dielalllldlpviavTGTnGKTTttsliaailkaa
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00464871   1/1  ----------------------------------PsekltlvGvTGTnGKTtvalllaqllellglkaal


                         -         -         *         -         -         -         -:140
query           FSSPYLIHYTDQISINGESISEARLEALMADYQSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAI
00416991   1/1  kvGlytSPhLldfnEriringepisdelllelfeeveaaleeldaegllsltfFelltllafllFaeakv
00528661   1/1  ytspglvlfneriringepisdellarlfeevlnalegnlnlgigvpltpfelltllalllfadegvdva
00421371   1/1  ligninneigerltlg................................................gvdlaV
00380851   1/1  ignignl.............................................igvpallllldggvdvaV
00454831   1/1  glvvalggnigvp..................................................lllllle
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00464871   1/1  iGTlgvllggellpaslTTpdalelqallael--------------------------------------


                         +         -         -         -         -         *         -:210
query           MEVGMGGLLDSTNVCQPILTGITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRI
00416991   1/1  dvavlEvGlGGrlDaTnvidplvavitsiglDHtdlLGdtleeIAleKaGiikpgvpvvlgdqepealev
00528661   1/1  VlEvgsgglldatnvldpdvavitniglDHldylgdtleeiaaaKagifkpggpavlnaddplvlavlee
00421371   1/1  lEvgssgllflt..lrpdvavitnigldHldylggtleaiaaakaeifkglppggvavlnaddpllaela
00380851   1/1  lEvssfdlgflldltnllrpdvavitnigldHldyhg.tleeyaaakaeifkglppggvavlnaddplla
00454831   1/1  gvdvaVlElssfql.grlellrpdvavitnispdHldrhgnslenyaaakleifeglgvavlnaddplll
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00464871   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AEEKDAPRLAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGRE
00416991   1/1  lleraeelgapllllgrdfsllllelalggllllllglgllldlllpllGehqllNaalAlaalell...
00528661   1/1  laaevltfgllvgadlraedielsldglrftllgpgglllelelpllGrhnvlNalaAlaa.........
00421371   1/1  eragarvvtfgldegadlraldivltldgttftlllpgglllelrlplpGrhnvlNalaAiaaalal...
00380851   1/1  allerla...garvvtfglddegadlraldivllldgtsftlllpggllevelplpgrhnvlNalaAiaa
00454831   1/1  alae.....lgakvitfgldedadllalllgglllllllgllllllelplpglhnvlNalaAi-------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00464871   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADHHKEILFTCIKTKALED
00416991   1/1  ..glklseeaireglan-----------------------------------------------------
00528661   1/1  ........ilegLasfgvpgRlelvgegpgv---------------------------------------
00421371   1/1  ....gvdleaiaegL-------------------------------------------------------
00380851   1/1  alal.......gvdle------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00416981   1/1  -----------------GRlevlseggplvilDgAHnpdaaeallealrelfpggrlilvfgalgdkdir
00528651   1/1  ---------------lpGRlevlsggplvllDgAHnpdaleallealrellpg.rlilvfgalgdkdirg
00464861   1/1  ---------------vpGRfevlgevggptvivDyAHnPdaleallealre.fpggrliaVfgplgdkdt
00393921   1/1  --------------GvkgRfellgelevggvlvidDyAHhPdaieatlealrelfpdgrliavfgphgys
00464871   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQNLTDKKEEKQTVRIVTGSLYF
00416991   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00416981   1/1  gllgllaelfddvvivtl.dnpraedpeelaalllegglnvlviedvaeale.....spgdlvlvaGsly
00528651   1/1  llgllaelfddvvivtldnprgalpaeilalile..vlviadreeaieaalelad...gdlvlvaGslyl
00464861   1/1  rkrlemlaialsladvviltdd..nprgedpeelaaallagilgglnvlviadraeaieaalelak..pg
00393921   1/1  rdkglrdefaeals.ladvviltdvnpagedpieilddillglligglkvlviedreeaielalslakpg
00464871   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LSQVRAYLMERKNENGYTKD--------------------------------------------------
00416991   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00416981   1/1  lvgevlql--------------------------------------------------------------
00528651   1/1  vgevlkllle------------------------------------------------------------
00464861   1/1  dvvlvaGs--------------------------------------------------------------
00393921   1/1  .dvvlilGagditgq-------------------------------------------------------
00464871   1/1  ----------------------------------------------------------------------