[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55169.1


[Show Plain Result]

## Summary of Sequence Search
   1::347
 104::347  2.5e-85 47.3% 0036871 00368711 1/1   ependent acyltransferases               
 105::347  5.5e-83 46.7% 0035361 00353611 1/1   ependent acyltransferases               
 115::349    1e-78 47.2% 0049362 00493621 1/1   ependent acyltransferases               
 116::342  9.7e-56 40.7% 0045500 00455001 1/1   ependent acyltransferases               
 114::342  1.8e-44 37.6% 0041485 00414851 1/1   ependent acyltransferases               
   3::47   1.2e-09 45.2% 0035432 00354321 1/2   heral subunit-binding domain of 2-oxo a 
   7::47   4.2e-09 46.3% 0036891 00368911 1/2   heral subunit-binding domain of 2-oxo a 
  49::90   2.4e-08 38.1% 0035432 00354322 2/2   heral subunit-binding domain of 2-oxo a 
  50::90   2.6e-08 36.6% 0036891 00368912 2/2   heral subunit-binding domain of 2-oxo a 
   1::347


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIALEHNIAWQEIQ
00368711   1/1  ----------------------------------------------------------------------
00353611   1/1  ----------------------------------------------------------------------
00493621   1/1  ----------------------------------------------------------------------
00455001   1/1  ----------------------------------------------------------------------
00414851   1/1  ----------------------------------------------------------------------
00354321   1/2  --ggrvlasPavrklarelgvdlsqvkgtGpgGrilkeDvlaalekg-----------------------
00368911   1/2  ------lasPavrklarelgvdlsqvkgtGpgGrilkeDvlaalksg-----------------------
00354322   2/2  ------------------------------------------------vlasPavrklarelgvdlsqvk
00368912   2/2  -------------------------------------------------lasPavrklarelgvdlsqvk


                         -         -         *         -         -         -         -:140
query           GTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGKIERIPMTPMRKVIAQRMVESYLT
00368711   1/1  ---------------------------------apaaaaaalaaaaeeeriplsgirkaiakrlvesllt
00353611   1/1  ----------------------------------paaaaaslaaageeervplsgirkaiakrltesllt
00493621   1/1  --------------------------------------------lgeeervplsgirkaiakrlveslqt
00455001   1/1  ---------------------------------------------mevelidlsgwrrkeafnlfrslv.
00414851   1/1  -------------------------------------------kmmfetidlltwvRkeifefflnsl..
00354321   1/2  ----------------------------------------------------------------------
00368911   1/2  ----------------------------------------------------------------------
00354322   2/2  gtGpgGrilkeDvlaalekg--------------------------------------------------
00368912   2/2  gtGpgGrilkeDvlaalksg--------------------------------------------------


                         +         -         -         -         -         *         -:210
query           APTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNY
00368711   1/1  iPhvtltvevdvtallelrkelkdll.ekkgvklsflpflikavalalkefPelnasldddgeeivlkdy
00353611   1/1  iPhvtlfvevdvtallelrkelkdll.ekegvklsflaflikavalalkefPelnasldgdkeeivlkky
00493621   1/1  iPhvtltvevdvtallelrkelkdalekkegvklsflaflikavalAlkevPelnasidgde..ivlkdy
00455001   1/1  iPhvsltvevditellelrk..........gvkltflpflikavakalnefpefnarid..ggelvlkdy
00414851   1/1  iptfsltvevDitnllklrk..........gkklsflpfllyavakalnehpefrlrid..ggelvlfde
00354321   1/2  ----------------------------------------------------------------------
00368911   1/2  ----------------------------------------------------------------------
00354322   2/2  ----------------------------------------------------------------------
00368912   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VNLAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGP
00368711   1/1  vnigvAvdtpdgLvvPviknadklslaeiakeikdlakkardgklkpeelqggtftiSnlGmfgvllftp
00353611   1/1  vnigvAvdtpdgLvvPviknadklslaelakelkdlaekaregklkpeelqggtftisnlGmfgvllftP
00493621   1/1  vnigvAvdtpdglvvPvirdadklslaeiakelkdlaekaregkltpeelqggtftisnlGmigvllftp
00455001   1/1  vnigiavfhkdtdtfsgllvpvikdadkFlksllelakeiselaelarkg.....dlpggtftiSnlpwl
00414851   1/1  vnpgytvftkdgltfsviwtaydkdflefakeykeliekarelgklfpkdlpgntftisnlPwvgftsft
00354321   1/2  ----------------------------------------------------------------------
00368911   1/2  ----------------------------------------------------------------------
00354322   2/2  ----------------------------------------------------------------------
00368912   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI---
00368711   1/1  iinppqvailgvgkivkrpvvvdgeivvrlvmplslsyDHRvidGaeaarflnalkelledpallll---
00353611   1/1  iinppqvAilgvgaivkrpvvvdgeivvrkvmplslsyDHRvidGaeaarflnalkelledpallll---
00493621   1/1  iinppqvailgvgaivkrpvvvdgeivirkvmplslsyDHrvidGaeaarFlkalkelLenpellllel-
00455001   1/1  gftsftpiinapevailpvgtigkrpvvng.....rlllpLslsvdHrviDGahaarFlnrl--------
00414851   1/1  liinnpevailPiftigkypvv.dg....klllPLslqvdHavvDGahaarFlnelqelled--------
00354321   1/2  ----------------------------------------------------------------------
00368911   1/2  ----------------------------------------------------------------------
00354322   2/2  ----------------------------------------------------------------------
00368912   2/2  ----------------------------------------------------------------------