[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55177.1


[Show Plain Result]

## Summary of Sequence Search
   1::141
  10::111  1.3e-08 35.4% 0051979 00519791 1/1   wall binding repeat                     
  47::111  3.3e-08 40.4% 0038536 00385361 1/1   wall binding repeat                     
  30::78   0.00073 31.2% 0047093 00470931 1/1   wall binding repeat                     
   1::141


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDPLSGE
00519791   1/1  ---------vllangwvtengnwyyflidsdgkmvtgwvlidgkwyyfdsdgtlvkngwieidgkwyyfd
00385361   1/1  ----------------------------------------------dgvaltglvtingkyyYfds.sgy
00470931   1/1  -----------------------------lledglevltgwvqdnggwyyldedgsvatggWlkingkwY


                         -         -         *         -         -         -         -:140
query           MVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAE
00519791   1/1  sngvmvtgwvkidgkwyyfdsngymvkgwvyddgkwyyfds-----------------------------
00385361   1/1  mvkglfi.................vtidgkwyYfdndGkmv-----------------------------
00470931   1/1  Yfds.dGy--------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           K---------------------------------------------------------------------
00519791   1/1  ----------------------------------------------------------------------
00385361   1/1  ----------------------------------------------------------------------
00470931   1/1  ----------------------------------------------------------------------