[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55178.1


[Show Plain Result]

## Summary of Sequence Search
   1::543
   1::213  4.9e-43 28.1% 0040302 00403021 1/1   in kinase-like (PK-like)                
   1::153  5.2e-43 34.6% 0044924 00449241 1/1   in kinase-like (PK-like)                
   1::195  4.7e-40 28.6% 0034801 00348011 1/1   in kinase-like (PK-like)                
   1::258  1.1e-39 22.7% 0041927 00419271 1/1   in kinase-like (PK-like)                
   1::151  1.8e-39 35.9% 0038659 00386591 1/1   in kinase-like (PK-like)                
   1::176  4.2e-39 29.7% 0043074 00430741 1/1   in kinase-like (PK-like)                
   1::151  6.1e-39 33.1% 0040180 00401801 1/1   in kinase-like (PK-like)                
   1::153  1.1e-38 36.2% 0035371 00353711 1/1   in kinase-like (PK-like)                
   1::153  1.4e-38 34.9% 0049348 00493481 1/1   in kinase-like (PK-like)                
   1::213  1.6e-38 26.2% 0044036 00440361 1/1   in kinase-like (PK-like)                
   1::220  1.8e-38 25.8% 0040179 00401791 1/1   in kinase-like (PK-like)                
   1::151    2e-38 33.8% 0051877 00518771 1/1   in kinase-like (PK-like)                
   1::153  2.1e-38 36.2% 0041719 00417191 1/1   in kinase-like (PK-like)                
   1::217  2.1e-38 25.5% 0050990 00509901 1/1   in kinase-like (PK-like)                
   1::174    7e-38 33.1% 0047734 00477341 1/1   in kinase-like (PK-like)                
   1::153  7.7e-38 34.0% 0037369 00373691 1/1   in kinase-like (PK-like)                
   1::215    8e-38 26.6% 0037714 00377141 1/1   in kinase-like (PK-like)                
   1::179  1.1e-37 28.7% 0036031 00360311 1/1   in kinase-like (PK-like)                
   1::149  1.4e-37 34.7% 0047088 00470881 1/1   in kinase-like (PK-like)                
   1::153  1.5e-37 32.9% 0040670 00406701 1/1   in kinase-like (PK-like)                
   1::153  1.6e-37 36.5% 0038373 00383731 1/1   in kinase-like (PK-like)                
   1::153  2.3e-37 35.3% 0039603 00396031 1/1   in kinase-like (PK-like)                
   1::173  3.7e-37 31.4% 0039145 00391451 1/1   in kinase-like (PK-like)                
   1::200    4e-37 26.6% 0048785 00487851 1/1   in kinase-like (PK-like)                
   1::153  5.4e-37 33.6% 0049347 00493471 1/1   in kinase-like (PK-like)                
   1::153  6.3e-37 35.1% 0053164 00531641 1/1   in kinase-like (PK-like)                
   1::182  7.2e-37 30.1% 0037803 00378031 1/1   in kinase-like (PK-like)                
   1::153  7.7e-37 34.9% 0042707 00427071 1/1   in kinase-like (PK-like)                
   1::153  8.4e-37 34.7% 0042315 00423151 1/1   in kinase-like (PK-like)                
   1::151  1.1e-36 34.9% 0041710 00417101 1/1   in kinase-like (PK-like)                
   1::151  1.2e-36 33.6% 0052889 00528891 1/1   in kinase-like (PK-like)                
   1::199  1.3e-36 27.6% 0038477 00384771 1/1   in kinase-like (PK-like)                
   1::212  1.4e-36 27.0% 0035157 00351571 1/1   in kinase-like (PK-like)                
   1::153    2e-36 34.0% 0043269 00432691 1/1   in kinase-like (PK-like)                
   1::170    3e-36 32.5% 0037668 00376681 1/1   in kinase-like (PK-like)                
   1::153  3.1e-36 32.7% 0035615 00356151 1/1   in kinase-like (PK-like)                
   1::151  3.1e-36 35.4% 0046180 00461801 1/1   in kinase-like (PK-like)                
   1::160  3.5e-36 34.0% 0046998 00469981 1/1   in kinase-like (PK-like)                
   1::151  4.5e-36 32.4% 0044407 00444071 1/1   in kinase-like (PK-like)                
   1::205  4.8e-36 27.9% 0040727 00407271 1/1   in kinase-like (PK-like)                
   1::153    5e-36 34.2% 0037572 00375721 1/1   in kinase-like (PK-like)                
   1::166  6.5e-36 32.7% 0048206 00482061 1/1   in kinase-like (PK-like)                
   1::153  9.4e-36 35.3% 0044907 00449071 1/1   in kinase-like (PK-like)                
   1::151  9.7e-36 32.4% 0048011 00480111 1/1   in kinase-like (PK-like)                
   1::153    1e-35 34.2% 0041048 00410481 1/1   in kinase-like (PK-like)                
   1::153  1.2e-35 34.2% 0042918 00429181 1/1   in kinase-like (PK-like)                
   1::194  1.3e-35 31.2% 0049795 00497951 1/1   in kinase-like (PK-like)                
   1::153  2.6e-35 35.5% 0044547 00445471 1/1   in kinase-like (PK-like)                
   1::153  3.3e-35 34.4% 0038940 00389401 1/1   in kinase-like (PK-like)                
   1::153  3.6e-35 36.0% 0044203 00442031 1/1   in kinase-like (PK-like)                
   1::149  5.6e-35 34.7% 0049834 00498341 1/1   in kinase-like (PK-like)                
   1::153  7.8e-35 32.9% 0037731 00377311 1/1   in kinase-like (PK-like)                
   1::167  1.1e-34 34.0% 0050905 00509051 1/1   in kinase-like (PK-like)                
   1::150  1.5e-34 31.8% 0041767 00417671 1/1   in kinase-like (PK-like)                
   1::153  1.5e-34 34.9% 0049786 00497861 1/1   in kinase-like (PK-like)                
   1::149  1.7e-34 33.6% 0039792 00397921 1/1   in kinase-like (PK-like)                
   1::154  1.8e-34 34.0% 0049538 00495381 1/1   in kinase-like (PK-like)                
   1::153  3.5e-34 34.0% 0042354 00423541 1/1   in kinase-like (PK-like)                
   1::161    5e-34 35.1% 0046042 00460421 1/1   in kinase-like (PK-like)                
   1::151  6.4e-34 35.8% 0051133 00511331 1/1   in kinase-like (PK-like)                
   1::153  6.5e-34 34.2% 0039686 00396861 1/1   in kinase-like (PK-like)                
   1::153  1.6e-33 37.2% 0041095 00410951 1/1   in kinase-like (PK-like)                
   1::153  1.7e-33 33.6% 0039870 00398701 1/1   in kinase-like (PK-like)                
   3::170  2.1e-33 33.7% 0046210 00462101 1/1   in kinase-like (PK-like)                
   1::150  3.6e-33 31.8% 0038413 00384131 1/1   in kinase-like (PK-like)                
   1::153  5.5e-33 34.9% 0043658 00436581 1/1   in kinase-like (PK-like)                
   1::83   1.6e-22 41.5% 0044090 00440901 1/1   in kinase-like (PK-like)                
   5::90   1.3e-08 31.9% 0039408 00394081 1/1   in kinase-like (PK-like)                
  14::87   2.1e-06 29.9% 0041315 00413151 1/1   in kinase-like (PK-like)                
   6::42   3.2e-05 32.4% 0046494 00464941 1/1   in kinase-like (PK-like)                
  10::42   7.7e-05 48.5% 0041592 00415921 1/1   in kinase-like (PK-like)                
 253::317   0.0017 29.8% 0043332 00433321 1/2   illin-binding protein 2x (pbp-2x), c-te 
 465::535       89 33.3% 0043332 00433322 2/2   illin-binding protein 2x (pbp-2x), c-te 
   1::543


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
00403021   1/1  alqilsaLeyLHslgiiHRDlKpeNiLldsldsdgvvklaDFGlarllsdg..tllttvvgtpgYmAPEv
00449241   1/1  alqillaLeyLHslgiiHRDlKpeNiLldedgvvklaDFGlarllssdeltllttvvgtpgYmAPEvllg
00348011   1/1  alqilsaLaylhslgiiHrDlKpeNiLllsldedgvvklaDFGlarlldsd..tllttvvgtpgYmAPEv
00419271   1/1  alqilsaLeyLHslgiiHRDlKpeNiLldedgvvklaDFGlarllsdge...lttvvgTpgYmAPEvllg
00386591   1/1  alqilraLeyLHsklgiiHrDlKPeNiLldlldslledgvvklaDFGlarllddt....lttvvgtpgYm
00430741   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllllttvvgtpgYmAPEv
00401801   1/1  alqilsgLeyLHslgiiHrDlKpeNiLldeddlgvvklaDFGlarllsdd..tllttvvgTpgYmAPEvl
00353711   1/1  alqiargLayLHelllgllgskgiiHrDlKpeNiLldedgvvklaDFGlarllssdettlllllttvvgt
00493481   1/1  alqillaLaylhselgiiHrDlKPeNiLldsdgvvklaDFGlarllddd...llttvvgTpgYmAPEvll
00440361   1/1  alqilsaLeyLHslgiiHrDlKpeNiLldlledgvvklaDFGlarllssg..tllttvvgtpgYmAPEvl
00401791   1/1  alqilsgLayLHslgiiHRDlKpeNiLldedllgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvl
00518771   1/1  alqillgLaylHslgiiHRDlKPeNiLldsdgvvklaDFGlArllsdd..tllttvvgTpgYmAPEvllg
00417191   1/1  alqilsaLeylhslgiiHrDlKpeNiLldedgvvklaDFGlarllldglltllllttvvgtpgYmaPEvl
00509901   1/1  alqillaLeylhslgiiHRDlKpeNiLldedgvvklaDFGlarllssge.tllttvvgTpgYmAPEvllg
00477341   1/1  alqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDFGlarllsdselllllttlvgtpgYmaPEvll
00373691   1/1  alqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllssdetl.lttvvgtpgYmAPEvllg
00377141   1/1  alqillaLeyLHslgiiHrDlKpeNiLldedgvvklaDFGlarllddg....lttvvgtpgYmAPEvllg
00360311   1/1  alqilsaLeylHskgiiHrDlKpeNilldlldedgvvklaDFGlarllldgettlllllrllttlvgtpg
00470881   1/1  alqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllss.dltllttvvgTpgYmAPEvllg
00406701   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllttvvgtpgYmAPEvll
00383731   1/1  alqilsaLeylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgelllllttvvgtpgYmAPEvll
00396031   1/1  alqilsaLaylhslgiiHrDlKpeNiLldsdglsllvvklaDFGlarllssd..tllttvvgtpgYmAPE
00391451   1/1  alqiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGlarllssgeltlllttvvgtpgYmAPEvll
00487851   1/1  alqilsgLeyLHskgiiHrDlKpeNilldsdgvvklaDFGlarllsddeltltllttlvgtpgYmAPEvl
00493471   1/1  alqilrgLaylHsklgiiHrDlKPeNiLldedgvvklaDFGlarllddd...llttvvgTpgYmAPEvll
00531641   1/1  alqillaLaylhsllslllgiiHrDlKpeNiLldedgvvklaDFGlarllssdl.tllttvvgtpgYmAP
00378031   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssddll..ttvvgtpgYmAPEvllg
00427071   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssdellllttvvgtpgYmAPEvllg
00423151   1/1  alqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarlldsg..tllttvvgtpgYmAPEvllg
00417101   1/1  alqilsaLeyLHskgiiHRDlKpeNiLldedgvvklaDFGlarllssge.tllttvvgtpgYmAPEvllg
00528891   1/1  alqillgLaylHslgiiHRDlKpeNiLldedgvvklaDFGlArllddt....lttvvgTpgYmAPEvllg
00384771   1/1  alqilrgLayLHslgiiHrDlKpeNiLldedlgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvll
00351571   1/1  alqillaLeyLHskgiiHRDlKpeNiLldedgvvklaDFGlarllgdg....lttvvgtpgYmAPEvllg
00432691   1/1  alqiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGlarllssgettlllttvvgtpgYmAPEvll
00376681   1/1  alqiargLayLhslgiiHrDlKpsNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllg
00356151   1/1  alqilrgLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssd..tllttvvgtpgYmAPEvllg
00461801   1/1  alqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllddd....lttlvgtpgYmAPEvllg
00469981   1/1  alqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllsddeltlllttlvgtpgYmaPEvll
00444071   1/1  alqilsgLayLHslgiiHRDlKpeNiLldsdgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvllg
00407271   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgettlllttvvgtpgYmAPEvll
00375721   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgestlllttvvgtpgYmAPEvll
00482061   1/1  alqilsaleyLHskgiiHrDlkpeNilldedgvvkliDfGlarllsddeltllttlvgtpgYmaPEvllg
00449071   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgeltlllttvvgtpgYmAPEvll
00480111   1/1  alqilsgLeyLHskgiiHrDlKpeNilldledgvvklaDFGlarllsddel..lttlvgtpgYmAPEvll
00410481   1/1  alqiargLayLhslgiiHrDlKpsNiLldedgvvklaDFGlarllssdellllllttvvgtpgYmAPEvl
00429181   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllg
00497951   1/1  alqillgLaylhslgiiHRDlKpeNiLldedgvvklaDFGlarllssd.....ttvvgtpgYmAPEvlll
00445471   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssslsllllttvvgtpgYmAPEvll
00389401   1/1  alqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgetllllttvvgtpgYmAPEvll
00442031   1/1  alqiasgLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsddlllllllttvvgtpgYmAPEvl
00498341   1/1  alqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlArllssdgtl.lttvvgTpgYmAPEvllg
00377311   1/1  alqiasglayLhslgiiHrDlKpeNiLldedgvvklaDFGlarlllsgellllttvvgtpgYmAPEvllg
00509051   1/1  alqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDfGlarllsddeltllllttlvgtpgYmaPEvl
00417671   1/1  alqilrgLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllssgltl.lttvvgtpgYmAPEvllg
00497861   1/1  alqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDFGlarllsdseltllllttlvgtpgYmaPEvl
00397921   1/1  alqilsaLeyLHslgiiHrDlKpeNiLldedlgvvklaDFGlarllsdd..tllttvvgtpgYmAPEvll
00495381   1/1  alqilsaleyLHslgppiiHrDlkpeNilldedlgvvkliDfGlarllsdd...llttlvgtpgYmaPEv
00423541   1/1  alqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgetllllttvvgtpgYmAPEvll
00460421   1/1  alqilsaleyLHskgiiHrDlkpeNilldedgvvkliDfGl......lsltllttlvgtpgllYmaPEvl
00511331   1/1  alqillaleylhslgiiHrDlKpeNiLldledgvvklaDFGlarlldde...llttlvgtpgYmAPEvll
00396861   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsssellllllllttvvgtpgYmAPE
00410951   1/1  alqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsssl...lttvvgtpgYmaPEvllg
00398701   1/1  alqiargLayLhslgiiHrDlkpeNiLldedgvvklaDFGlarlllsdellllttvvgtpgYmaPEvllg
00462101   1/1  --qllsaleylHskgivHrDlkpsNillglgdsdedgrvkliDFGlarllldpksgklityrekkslvgt
00384131   1/1  alqilsgLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgltl.lttvvgtpgYmAPEvllg
00436581   1/1  alqiargLayLhslgiiHrDlkpeNiLldedgvvklaDFGlarllssdlllllttvvgtpgYmAPEvllg
00440901   1/1  lrqllealaylhsagivHrDlkpeNilldedg.vkliDFglarlldepedlalllrdlvgtpaymaPEvl
00394081   1/1  ----leallpdlplvliHgDlhpgNilvddgkvsgliDfglag.............lgdpayDlafllrs
00413151   1/1  -------------lvlvHgDlhpgNilvddgrvvgliDfglagvgdpayDLalllrdlshplaeellary
00464941   1/1  -----lAlysivgyilglgDrhpgNilldktGhivhiDFGfi----------------------------
00415921   1/1  ---------lgsplvfcHnDlkpgNiLllkddssgsvlifdd----------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLT
00403021   1/1  llgkpytpksDvWSlGvvlyelltgrppfpglsplelllkilkglgtpdlllrlplppglspelkdlilk
00449241   1/1  gplyyspksDvwSlGvvlyelltgrppfdglsplellllilkglltpplplppglspelldlilkclqkd
00348011   1/1  llggpyspksDvwSlGvvlyelltgrppfdglsllellllilkglllpllelppllspelldlilkclqk
00419271   1/1  gpyygpksDvWSlGvvlyelltgrppfdgesplelllkilkl.lglplplppglspelkdlilkclqkdp
00386591   1/1  APEvllggpyspksDvWSlGvilyelltgrppfdglsasdllleldqlalilellgtpplellllllllr
00430741   1/1  llggkyttksDvwSfGvvlyelltlgrppfdglsplellelilkglrl...plpeelspelldlilkclq
00401801   1/1  lggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkglglppeelppglspelkdlilkclqkd
00353711   1/1  pgYmAPEvllgglgllllkyttksDvwSlGvvlyelltgrppfdglsplelllkilkgllllpeevlpll
00493481   1/1  ggpydtksDvwSlGvvlyelltgrppfpgesllellllilkgklslllgtpslellllllslllllllll
00440361   1/1  lggpyspksDvWSlGvvlyelltgrppfpglsllelllkilkglllpllelppglspelldlilkclqkd
00401791   1/1  lggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkglglpplelppglspelldlilkclqkd
00518771   1/1  kpydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppeelllsllllllllllllllllll
00417191   1/1  lggpystksDvwslGvvlyelltgrppfdglsllellllilkglllpllelppglspelldlilkclakd
00509901   1/1  kpydakvDvWSlGvilyelltgrppfpgesllelllkilkgllplp....edlspelkdlilkllqkdpe
00477341   1/1  ggpyspksDvwslGvvlyelltlgklpfdglsplellekilegllp...plpedlspelkdlilkclqkd
00373691   1/1  ggyspksDvwSlGvvlyelltgrppfdglsllellllilkglglll.plppllspelldlilkclqkdpe
00377141   1/1  gpyteksDvWSlGvvlyelltgrppfdglsplellllilkgllplp....eelspelkdlilkclqkdpe
00360311   1/1  YmaPEvllggpysrksDvwSlGvvlyelltgrlpfpglselelllkilkglglllllllpllppglspel
00470881   1/1  lkyystkvDvWSlGvilyelltgrppfpglsllellllilkllgtpslelllllllllllllllllldpl
00406701   1/1  ggkyttksDvwSlGvvlyelltlgrppfpglsplellllilkglrl...plpedlspelldlilrclakd
00383731   1/1  ggkyspksDvwSlGvvlyelltgrppfdglsllellllilkgllplp....eelspelldlilkclakdp
00396031   1/1  vllggpyspksDvwSlGvvlyelltgrppfpglsllellllilkglllpllelppllspelldlilkcla
00391451   1/1  ggkyttksDvwSlGvvlyelltlgrppfdglsplellelilkglrl...plpellspelldlilkclqkd
00487851   1/1  lglgpyspksDvwslGvilyelltgkppfpglsplellekilkllgtpslellllllslllldllkllrl
00493471   1/1  ggpydtksDvwSlGvvlyelltgrppfpgesllelllkilkglgtpseellplllsllllllllllllll
00531641   1/1  EvllgkpydlksDvwslGvvlyelltgrppfpglsllellllilkglllpl...pellspelldlilkcl
00378031   1/1  gkyteksDvwSlGvvlyelltlgrppfdglsplellelilkglrl...plpedlspelldlilkclqkdp
00427071   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlpl...pellspelldlilkclakdp
00423151   1/1  llslllgkyslksDvwSlGvvlyelltgrppfdglsllellllilrglllpllelppllspelldlilkc
00417101   1/1  gpyspksDvWSlGvvlyelltgrppfdglsplelllkilkgllplp....ellspelkdlilkclqkdpe
00528891   1/1  lkgydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppeelllllllllllllllllllvd
00384771   1/1  gglkyttksDvWSlGvvlyelltgrppfdgeselelllkilkglgtpslellllvlsllllglllelldp
00351571   1/1  gpyspksDvWSlGvvlyelltgrppfpglsplelllkilkgllpl....peglspelkdlilkclqkdpe
00432691   1/1  ggkyttksDvWSlGvvlyelltlgrppfpglsplellekildgllrpp..lppelspelldlilkclqkd
00376681   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlpl...pellspelldlilkclakdp
00356151   1/1  gkystksDvWSlGvvlyelltgrppfdglselellllilkglgtpslelllllllllllllllldlllll
00461801   1/1  lgpyspksDvwslGvilyelltgkppfdgesplellekilkllgtpplelllklllllllllldllllll
00469981   1/1  ggpyspksDvwslGvilyelltlgklpfdglsplellekilkglrlplped...lspelkdlilkclqkd
00444071   1/1  gpystksDvWSlGvvlyelltgrppfpgeselelllkilkglgtpplellllllllllllllllllllll
00407271   1/1  ggkyteksDvwSlGvvlyelltlgrppfdglsplellekilkglrl...plpedlspelldlilkclqkd
00375721   1/1  ggkyttksDvwSlGvvlyelltlgrppfdglsplellllilkglrlpl...pellspelldlilkclqkd
00482061   1/1  gpyspksDvwslGvilyelltlgklpfpglsllellekileglllplpe...dlspelldlilkclqldp
00449071   1/1  ggkyttksDvwSlGvvlyelltlgrppfpglsllellllilkgllrpp..lppllspelldlilkclqkd
00480111   1/1  ggpyyspksDvwslGvilyelltgklPlfdglsplellelilkglglpppelllelldlllldlllllll
00410481   1/1  lggkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrl...plpellspelldlilrclak
00429181   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlpl...pellspelldlilkclaldp
00497951   1/1  lgggkydeksDvwSlGvvlyelltgrppfdglsllellllilkgllrpl..lppllspelkdlilkclqk
00445471   1/1  gllggkyttksDvwSlGvvlyelltgrlpfdglsllellllilkglllpllllllppllspelldlilkc
00389401   1/1  ggpyyslksDvwSlGvvlyelltgrppfdglsllellllilkglllll.llppllspelldlilkclald
00442031   1/1  lggkystksDvwSlGvvlyelltlgrppfdglsllellllilkgllrlp..lppelspelldlilkclak
00498341   1/1  lkyystkvDvWSlGvilyelltgrppfpglsllellllilkllgtpslelllsllllllllllllldlll
00377311   1/1  gkystksDvwSlGvvlyelltlgrppfdglsllellllilkglrlpl...pellspelldlilkclqldp
00509051   1/1  lggpyspksDvwslGvilyelltlgklpfdglsplellekilkglrpplp...pglspelldlilkclql
00417671   1/1  glkystksDvwSlGvvlyelltgrppfpglsllellllilkllgtpslelllllllllllllllllldll
00497861   1/1  lggpyspksDvwslGvvlyelltlgklpfdglsllellekilkgllp...plpedlspelkdlilkclql
00397921   1/1  glgkyspksDvWSlGvvlyelltgrppfdpgeselelllkilkglgtpslelllklllllllllllllll
00495381   1/1  llg.pyspksDvwslGvilyelltgklpfdglldldellekilelglplp..lpellspelkdlilkclq
00423541   1/1  ggkyttksDvwSlGvvlyelltlgrppfpglsllelllkildgllrppl..ppllspelldlilkclqkd
00460421   1/1  lggpyspksDvwslGvilyelltlgklpfdglsllellelilkglllplp...pelspelldlilkclql
00511331   1/1  glpyyglkvDvwslGvilyelltgrlpfpglsllelllli..........lppllspelldlilkllqkd
00396861   1/1  vllggkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrl...plpeelspelldlilkcl
00410951   1/1  glyslksDvwslGvvlyelltgrppfdglsllellllilkgllplp....eelspelldlilkclaldpe
00398701   1/1  gkytlksDvwSlGvvlyelltlgkppfpglsllellllilkglrl...plpellseelldlilkclaldp
00462101   1/1  pgYmapevllgkeysrksDiwslGvilyelltgklpfqglsdlellekikkilelklptppeellkglpe
00384131   1/1  gkyystksDvwSlGvvlyelltgrppflpglsllellllilkglgtpslelllllllllllllllllldl
00436581   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlpl...pellspelldlilkclakdp
00440901   1/1  lgkpygpasDiws---------------------------------------------------------
00394081   1/1  lafdyldpelaeeflegygi--------------------------------------------------
00413151   1/1  laaygllapdlarl...-----------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVSQSTLTSIPKVQAQTEHKSIKNPSQAV
00403021   1/1  clakdpekRp.taeellehpflkgllllllllllllppllplllsllllslllllllssllslsslslsl
00449241   1/1  pekRptmaevvae---------------------------------------------------------
00348011   1/1  dpekRp.taeellehlffllllllllllllllllllllllllsllsslllsslll---------------
00419271   1/1  ekRptmaevv...aeellehpffrglllllllllllppplvpllsslldlssldllllslllllllllll
00386591   1/1  lllllllllll-----------------------------------------------------------
00430741   1/1  kdpekRp.tasevlehlfflllllelllllllllll----------------------------------
00401801   1/1  pekRp.taeel-----------------------------------------------------------
00353711   1/1  lslrllelldpll---------------------------------------------------------
00493481   1/1  lllleglllelld---------------------------------------------------------
00440361   1/1  pekRp.taeellehpflkglllllllllllllllllllllllllslllllllslllllsllslsllslll
00401791   1/1  pekRp.taeellehpflkgllllllllllllppllpllssllslslllllllssslslslsssslssssl
00518771   1/1  llllllllldl-----------------------------------------------------------
00417191   1/1  pekRp.saaelle---------------------------------------------------------
00509901   1/1  kRptaaeellehpfflgllllllllllllllllpllllllllslllllllllllllllllslllllllll
00477341   1/1  pekRp.saeellehLepllklllllldllllle.------------------------------------
00373691   1/1  kRp.tasellehl---------------------------------------------------------
00377141   1/1  kRptmaevvaeellehpfllgllllllllllllllllpllllllllslllllllllllllllllssllll
00360311   1/1  ldlllkclaldpekRp.saeellellehpffklllllll-------------------------------
00470881   1/1  lllllppll-------------------------------------------------------------
00406701   1/1  pekRp.tasevle---------------------------------------------------------
00383731   1/1  ekRp.taeellkh---------------------------------------------------------
00396031   1/1  kdpekRp.saeel---------------------------------------------------------
00391451   1/1  pekRp.tasevlehlfflllllellllllllpl-------------------------------------
00487851   1/1  ldpglrlelppnlspelkdlilkclqkdpekRp.taeellehpflkglllpllelllppl----------
00493471   1/1  llvllllleglll---------------------------------------------------------
00531641   1/1  akdpekRp.saee---------------------------------------------------------
00378031   1/1  ekRp.tasevlehlfflllllellllllllllllllllslld----------------------------
00427071   1/1  ekRp.tasevleh---------------------------------------------------------
00423151   1/1  lqkdpekRp.tae---------------------------------------------------------
00417101   1/1  kRpgsleetae-----------------------------------------------------------
00528891   1/1  pllllllppll-----------------------------------------------------------
00384771   1/1  rlllplppelspelldlllkclqkdpekRp.taeevlehpflkellllllllllppllp-----------
00351571   1/1  kRptsaevvaeellehpfflgllllllllllllppllplllslldlslldllllsllllllllsssssll
00432691   1/1  pekRp.tasevle---------------------------------------------------------
00376681   1/1  ekRp.tasevlehlfflllllellllllll----------------------------------------
00356151   1/1  plppllseelldl---------------------------------------------------------
00461801   1/1  gllrlplpen.-----------------------------------------------------------
00469981   1/1  pekRp.saeellehlfklld--------------------------------------------------
00444071   1/1  llglllllldl-----------------------------------------------------------
00407271   1/1  pekRp.tasellehlffllllllllllllllllllllllllllllsllllllllllllsllllsl-----
00375721   1/1  pekRp.tasevle---------------------------------------------------------
00482061   1/1  ekRp.saeellehlffllllle...a--------------------------------------------
00449071   1/1  pekRp.tasevle---------------------------------------------------------
00480111   1/1  lleelpllsll-----------------------------------------------------------
00410481   1/1  dpekRp.tasevl---------------------------------------------------------
00429181   1/1  ekRp.tasevleh---------------------------------------------------------
00497951   1/1  dpekRp.saeellehlffllllllllllllllllllllllllllllsllsllll----------------
00445471   1/1  lakdpekRp.sas---------------------------------------------------------
00389401   1/1  pekRp.tasevle---------------------------------------------------------
00442031   1/1  dpekRp.sasevl---------------------------------------------------------
00498341   1/1  llelpplls-------------------------------------------------------------
00377311   1/1  ekRp.tasevleh---------------------------------------------------------
00509051   1/1  dpekRp.saeel.ellllnllldllll-------------------------------------------
00417671   1/1  lllllpplls------------------------------------------------------------
00497861   1/1  dpekRp.saeell---------------------------------------------------------
00397921   1/1  llllelldp-------------------------------------------------------------
00495381   1/1  ldpekRp.saeell--------------------------------------------------------
00423541   1/1  pekRp.tasevle---------------------------------------------------------
00460421   1/1  dpekRp.saeellkhLeelde-------------------------------------------------
00511331   1/1  pekRp.taeel-----------------------------------------------------------
00396861   1/1  qkdpekRp.tase---------------------------------------------------------
00410951   1/1  kRp.sasellehl---------------------------------------------------------
00398701   1/1  ekRp.tasevlkh---------------------------------------------------------
00462101   1/1  elkdlikkllsldpeerp.syeellkllef----------------------------------------
00384131   1/1  llllllppll------------------------------------------------------------
00436581   1/1  ekRp.tasevleh---------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TEETYQPQAPKKHRFKMRYLILLASLVLVAASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGE
00403021   1/1  lss-------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00419271   1/1  lslllllslllsssslsllllsssllsslssllpslssslsslpspsg----------------------
00386591   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00440361   1/1  lsl-------------------------------------------------------------------
00401791   1/1  lsssslslls------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00509901   1/1  lllllll---------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00377141   1/1  llssp-----------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00351571   1/1  sg--------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ------------------------------------------evtvPdlvglsleealkllkllglkvev
00433322   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EKTEASEKVEEGRIIRTDPGAGTGRKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIK
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00386591   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  lGs........Gdlvvsqspkagtkvkkgskillllg---------------------------------
00433322   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IEEEESNESEAGTVLKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENL
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00386591   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IKIEEEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLIQIVGIK
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00386591   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  --------------------------------------------evtvPdlvglsleealkll......k


                         *         -         -         -         -         +         -:560
query           EANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP-----------------
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00386591   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00464941   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------
00433321   1/2  ----------------------------------------------------------------------
00433322   2/2  llglkvevlGs.......Gdlvvsqspkagtkv.kkgskillllg-------------------------