[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55228.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
   1::229  3.6e-73 38.7% 0049568 00495681 1/1   e and uridine phosphorylases            
   1::230  6.2e-70 43.5% 0039819 00398191 1/1   e and uridine phosphorylases            
   1::229  2.2e-60 36.8% 0047738 00477381 1/1   e and uridine phosphorylases            
   1::230  4.7e-59 35.9% 0050186 00501861 1/1   e and uridine phosphorylases            
   1::225    3e-56 34.9% 0051743 00517431 1/1   e and uridine phosphorylases            
   1::229  2.3e-51 33.0% 0048860 00488601 1/1   e and uridine phosphorylases            
   2::226  8.8e-51 32.0% 0039496 00394961 1/1   e and uridine phosphorylases            
   1::229  2.7e-49 34.9% 0051268 00512681 1/1   e and uridine phosphorylases            
   1::232  5.7e-47 32.3% 0048936 00489361 1/1   e and uridine phosphorylases            
  16::229  1.6e-42 28.8% 0041801 00418011 1/1   e and uridine phosphorylases            
   1::229  1.8e-41 26.1% 0048112 00481121 1/1   e and uridine phosphorylases            
   1::229  2.8e-41 27.4% 0045902 00459021 1/1   e and uridine phosphorylases            
   1::229  1.1e-37 26.2% 0046099 00460991 1/1   e and uridine phosphorylases            
   1::229  1.7e-35 24.8% 0050047 00500471 1/1   e and uridine phosphorylases            
   1::232  6.1e-32 23.6% 0050257 00502571 1/1   e and uridine phosphorylases            
   1::232  6.1e-23 21.3% 0046908 00469081 1/1   e and uridine phosphorylases            
  30::230  5.5e-18 26.3% 0046520 00465201 1/1   e and uridine phosphorylases            
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
00495681   1/1  tdaaaaverllelyersvkllrdalaalleggllpdedleerlravYPelrlttdgelaevdsrlafGlv
00398191   1/1  mkiviivAlpleakalaelledvevnevrgmlyytgtykgkevvvvltgiGkvnaaiattelialfgvdl
00477381   1/1  ledgllyhlglkpgdiglakiviiggdplrvkllaelledvelvtdirgfpfytgtlkgkpvvvvstGiG
00501861   1/1  ltyhlgakkgdvakiviiggdpervkllaellleevvlvtevrgflfytgtykgkpvvvvstgiGkpsaa
00517431   1/1  tyhlglkkgdiakiviiggdplevellaellldevelvldirgfpfytgtlkgkevvvvstgiGkvnaai
00488601   1/1  gltyhlglkpgdiakivilvgdplrvkllaelledvelvadvrgfltytgtykgkkvsvvstgiGkpsaa
00394961   1/1  -tyHlglkkgdiakvvllpgdplrvkliaellenaelvnevrgyliytgtykgkrvsvvshgiGipsaai
00512681   1/1  eeldlsldlltlhlglklgdiakivligglpleadalaelld....ieyrgiplytgtlggknvvlvrtg
00489361   1/1  lllesslllllelleeaaelildllgllkpkigiIgGsglgeladllldalveipyetipgfpsltvkfh
00418011   1/1  ---------------mtyhigakkgdiaevvllpgdplrvkliaetlldnvvlvnevrgyliytgtykgk
00481121   1/1  lsllllekleeaadlllsklglrpkigiigGsGlgdladaleeevetpygeipdfpvstveghsgklvlg
00459021   1/1  lllllelleeaaahikaklglvpkigiigGsglgdladaleeevetpygeipdfpvstveghsgklvtgt
00460991   1/1  kpkigiIgGSGlgdleilllleilyvetpfgphsgklvlgtlggvpvvflarhGrghlyephkvnyrani
00500471   1/1  lvpkiaiigGsglgvliiledipefpvstvaghpsgklvlgtlggkpvvflarhGrghlyephkvnyran
00502571   1/1  llekleeaaelllsklglkpkigiigGsGlgdladaleeevetpygeipgfpvstveghsgklvlgtlgg
00469081   1/1  lllekleeaadlilsktgllapkigiigGsglgdllelleevevetpygeipgfpvstvaghsgklvfgt
00465201   1/1  -----------------------------elllytgtykgkkisvvstGiGiPsasiyveeLiallgvkt


                         -         -         *         -         -         -         -:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
00495681   1/1  alpGvyattvtrPdlfrdylleqlglllrnygvpvevglsdteiPlpfaldggdlledgllalelrdlfd
00398191   1/1  iirvGtAGgldpdlkvgDvvvatgvvqhdvdatgfgyelgqfpglplafaadlallkaalkaakelglkv
00477381   1/1  kpnaaiaveelia.lgvktiiriGtaGgldpdlkvgdvviataairldg..tsfgylpgdvp.....apa
00501861   1/1  ialeeliallgvkliiriGtaGaldpdlkvgdvviataavrhdgd.safgylpgevp.....avadpell
00517431   1/1  aleeliallgvktiiriGtaGgldpdlkvgdvviataairld......gtspgylpgvdypapadpelle
00488601   1/1  ivleeLi.llgvktiiriGtaGalqpdllkvgdvviataavrddg..tsfgylpgeyp.....avadpel
00394961   1/1  vleeLi.lygvktiIrvGtaGalqedlkvgdvviataavrddgdtslfylplgq....pypavadfelld
00512681   1/1  iGkvnaaialreli.llgvkliirvGaaGglnpdlklGdvviaddaidyd......ggsllvl.gvefpa
00489361   1/1  agt.lggevrgvlarhGighlyegigvnaaraniellkalgvktiirtGaaGglnpdlkpgdlviatdai
00418011   1/1  rvsvvstgiGkpsaaivleeLia.lgvkaiirvGtaGalqpdlkvgdlviataavrdd......gtslly
00481121   1/1  tlggkpvvvflgrhGkyegaiptevnyranllkllgvdtliatgaaGglnpelkpgdlviiddhidltgg
00459021   1/1  lggvpVvvflgrhGkyegaiptevnyranllkllgvetliatgaaGglnpdlkpgdlviiddhidltgdr
00460991   1/1  ralke.lgvetliatgaaGglnedlkpgdlviiddhidltgdrdltfligpnderggvrhvdmadpydpe
00500471   1/1  iraLk.alGvktliatgaaGslnedlkpgdlvipddhidltggrpltffngggvrhvdmaapydpelrel
00502571   1/1  kpvvlrhGrfhlyeghglvnaranvraLka.lgvetliatgaaGglnpdlkpgdlvliddhidltggrpl
00469081   1/1  lggvpvvf.rhGrghlyeghsvnyralniralkllGvevliatnaaGglnedlkpgdlvliddhidltgg
00465201   1/1  liRvGtaGalqpdvklgdlviatgA......vrlsglsrlyflgldypavadfelllalveaakelgikv


                         +         -         -         -         -         *         -:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQAAHALNLPVLVIRAMSDNANHEANIFFDEF
00495681   1/1  lpdLaliddeianGlllpgeplplalftalrvdlslarlehytgtavehfqnyvlltnyqfyvdefielt
00398191   1/1  hvgliasgdsfvadaearlellklfpgalaveMEaaavaqvAalfgvpflviraisDladeganldweef
00477381   1/1  dpellealleaakelgikvhvGvvattdgfyretgrldglllsfpellpallrllrklgalaveMEsaal
00501861   1/1  eallkaakelgikvhvGliastdgfyaeterllkllkkfg.vlavEMEaaalaavaallgvpalailtvs
00517431   1/1  alleaakelgikvhvGviattdgfyaeteaelrllkkl.galaveMEtaalaavAallgvpalairavsD
00488601   1/1  lealveaaeelgikvhvGvvvttdgfyretgrpeklellrklgalavEMEsaalaavaallgvpalailt
00394961   1/1  alveaakelglkvhvGlvastdsfyreqerllkllkklg.vlavEMEaaalaalaallgvkalvvltvsd
00512681   1/1  padpellealleaakelgikvheGtiasgdgfyfetpaeirellrkl..gadaveMEaaalaavArelgi
00489361   1/1  dldgdstlfgvrfpdla........dp.ldkalreaakelgikvheGtyattdgfyfetpaeirllrkl.
00418011   1/1  lppldypavadfelldalvkaaeelglkvhvGlvastdgfyreteeklrllkklg.alavEMEaaalaal
00481121   1/1  rtatfligpnlerggvrfvdmsdpydpelrellleaakelgikvhlregvyvvvsGPrfe...tpaeirl
00459021   1/1  dvtpligpnlerggvrfvdmsapydpelrellleaaeelgikvhlregvyvvvsgPrfe...tpaeirml
00460991   1/1  lrellleaakelgikvhrggvyvvveGPrfetpae.irllrsl..gadavgMttvpeailArelglpyaa
00500471   1/1  lleaakelgikvhvggvyvvvsgPrfe.tpaeirmlrs.elgadavgMttapeailArelglpyaaislv
00502571   1/1  tgfndglfgvrfvdmsdpydpelrellleaak...lregvyvvveGPrfe...tpaeirllrllgadaVg
00469081   1/1  rpltgfn.....fvdmsdpydpelrellleaake....lreGvyvcveGPrf.etpaeirmlrllGadaV
00465201   1/1  hvGivlssdlFYagqerllellkkl.gvlavemEaaaLftlaallglkalavltvsdnlltgellsaeer


                         -         -         -         +         -         -         -:280
query           IIEAGRRSAQVLLTFLKALD--------------------------------------------------
00495681   1/1  philakpgdiakiviipad---------------------------------------------------
00398191   1/1  lalaakmsalallellelld--------------------------------------------------
00477381   1/1  aavaallgvpalairvvsd---------------------------------------------------
00501861   1/1  dnalggealsfeefletvak--------------------------------------------------
00517431   1/1  ladgeealsfeefle-------------------------------------------------------
00488601   1/1  vsdnllggelvllfeefle---------------------------------------------------
00394961   1/1  nllltgeittseelll------------------------------------------------------
00512681   1/1  pflvirgvsDyadghenvd---------------------------------------------------
00489361   1/1  gadaveMEtaaeaavArelgip------------------------------------------------
00418011   1/1  aallgvpalailtvsdnll---------------------------------------------------
00481121   1/1  lrllgadavgMstapeail---------------------------------------------------
00459021   1/1  rllgadavgMstapeailA---------------------------------------------------
00460991   1/1  islvtdyaagldsdepvsh---------------------------------------------------
00500471   1/1  tdyaagieepvtheevlet---------------------------------------------------
00502571   1/1  MstvpeailArelglpyaaisl------------------------------------------------
00469081   1/1  gMstvpeailArelglpyaais------------------------------------------------
00465201   1/1  eetfnemievaleaallnkl--------------------------------------------------