[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55245.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
   2::218  2.4e-63 34.6% 0044069 00440691 1/1   oxygenase-like                          
   1::213  1.3e-57 35.2% 0051513 00515131 1/1   oxygenase-like                          
   3::216  1.1e-56 33.0% 0052925 00529251 1/1   oxygenase-like                          
   1::216  8.5e-53 34.6% 0044286 00442861 1/1   oxygenase-like                          
   1::218  1.9e-51 32.7% 0048646 00486461 1/1   oxygenase-like                          
   2::213  4.2e-51 34.0% 0043377 00433771 1/1   oxygenase-like                          
   1::215  1.1e-48 31.0% 0052581 00525811 1/1   oxygenase-like                          
   2::213  1.3e-44 28.6% 0049145 00491451 1/1   oxygenase-like                          
  17::213  2.2e-31 30.6% 0050729 00507291 1/1   oxygenase-like                          
   1::216  7.9e-24 19.5% 0051692 00516921 1/1   oxygenase-like                          
   2::130  1.2e-05 20.3% 0047453 00474531 1/1   oxygenase-like                          
   1::219  8.2e-05 21.2% 0048277 00482771 1/1   oxygenase-like                          
   1::130  0.00019 21.2% 0050457 00504571 1/1   oxygenase-like                          
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
00440691   1/1  -efseeLrektaelwqaalnhpFvqaladGtlsreqfrayliqdyyylkhfarllaaalskapdlearrf
00515131   1/1  lllpllamsfterlleeaadlwqaalnhpfvqeladGtLpleaFryYlvqDylylkafaralalaaakap
00529251   1/1  --fterLleevaplweailnhpFvreladGtLpleafryYlvqdylylkhfaralalaaakapdledrrl
00442861   1/1  msmsfseqLreetadlwqaalnhpFvqeladGtlskeqfrayliqdyyylkhfaralaallakapdpear
00486461   1/1  lstlplsamefserLrekvaplw...inhpFvqgladGtLpreqfraYlaqdylYliafaralalaaaka
00433771   1/1  -lfteelleevqdlweailnhpFvqeladGtLsrelfraYliqdylylkhfaralaallskapd.ealrl
00525811   1/1  m.fserLreetaelweaalnhpfvqaladGtlsreafraylaqdylylkhfaralaaalakapdledrrl
00491451   1/1  -eFeerLreevaeiw..llehPfvqaladGklsleqfrayliqdylyvkhfprylaallakapdeelrra
00507291   1/1  ----------------katehpfveeladGtLdeekFkfyLkqDylflldfaralalllakapdlelm..
00516921   1/1  raksvallllllkgslestkldtpsamsfleqLlqetqdlaaevlnhPllqalrsGtlsreqyraflaqa
00474531   1/1  -slserLreaTrelheelenlpfiklllagrldlelYlrfllalyhvykaleellerlasrl........
00482771   1/1  vmsllerLreatrelheelenlpfikdllagllslelYlrfllalyhvykaleallerladhellapl..
00504571   1/1  pmdlserLreaTrelheelenlpfiklllagrlslelYlrfllalyhvyaaleellealadrp.......


                         -         -         *         -         -         -         -:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
00440691   1/1  llelilgelegelelhlrlaealGlsleelestepspatlaytdylldvaasgsllellaallpcewlya
00515131   1/1  dledmrllaellaallneElelhekflkelgisleeleatepspatlaYtdylldaaasgdylellaall
00529251   1/1  llellaellggelelhlrllkalgidledleateplpatraytdylldlaasgsllellaallpcewlya
00442861   1/1  ellldalael.egelelhlrlaealGldleellstepspatqayvdylldvaasgsllellaallpcewl
00486461   1/1  pdleerrllaerildhdGdallegelelhlrlaealgldleelestepvlpatraytdylldfa.sgsll
00433771   1/1  lldllag.leeelelhlrlaeelglsled....epspatlaytdylldlarsgdlaellaallpcewvyl
00525811   1/1  llenlleelggeegelelhlrlaealGldreel...pplpatrayvdylldlarsglsllealaallpce
00491451   1/1  llenileedggllghielwlrflealGldreellsaeplpatrayvdylldvarrgslaealaallplel
00507291   1/1  llllllailedEldlfeklaaelgid........pspatlaYtnyLlsl.asgsyaellaallpcewvYl
00516921   1/1  yyyvahtprllaaalarapdeelrralvqrie....eElghwewllnalGld..avsaiqplpavrayva
00474531   1/1  ...alaelaleelgrtealeaDLaalggddlwveipepspateayvaylyelaeegnpal----------
00482771   1/1  ........yipeelgrtealeaDLaalggdewveipepspateayvayl.helarenpalllghaYvlel
00504571   1/1  ....alaelylpelgrsealeaDLaalggldwvdlpepspatelyvaylye.iaeenpal----------


                         +         -         -         -         -         *         -:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
00440691   1/1  eigkrlaeklpenppyrewidlygseefreaveelralldrlaenlseeelerlleiflkalrlEldFwd
00515131   1/1  pcewlYleigkrlaerl.ednpykeWidlYaseefqeaveflialldrlae..seeelerleeiFlralr
00529251   1/1  eiakrlaerlkasednpykeWidlyasedfqehveeleelldrla....e.eqerlleifrtalrlEldf
00442861   1/1  yaeigkrlaeklkanpnhpylewidlygseefeeavellerllerl....seeeldelleiflkalrlel
00486461   1/1  ellaallpcewlypeigkrlldglpehydwidnpylewidtyaseefrd.vefllalldelae..seeeq
00433771   1/1  eiakrlakrlsenppykewidlyaseefreaveelealldelaetlseeeleelleiflkalrlEldFWd
00525811   1/1  wlygeiakrlaedllglnppylewidlyasldfqehveallalldrlaetldeeeqerlleifrralrle
00491451   1/1  lypeiarlllegllelygwlyeewlsyfrsheeldvrHaeealelvdelaet.e...qervleafllald
00507291   1/1  eaaellaee...pppYkewielysseeFaalvksleelvdelleglseee...aeeaflralelElaFWd
00516921   1/1  ylvnlarrgnplelvvallvleglsgqlakrlaeaipeglglpefleshagld..ehveeleallnkla.
00474531   1/1  ----------------------------------------------------------------------
00482771   1/1  GsllGgqvlakllakalgllpdlpgl..afylfegigdleelwrafralLdel..eldeeekdeiieeak
00504571   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MAYQHQTWKSDLQSLEKGEE--------------------------------------------------
00440691   1/1  mayrlekw--------------------------------------------------------------
00515131   1/1  lEl-------------------------------------------------------------------
00529251   1/1  wdmaye----------------------------------------------------------------
00442861   1/1  dFwdma----------------------------------------------------------------
00486461   1/1  erlleifk--------------------------------------------------------------
00433771   1/1  may-------------------------------------------------------------------
00525811   1/1  lafwd-----------------------------------------------------------------
00491451   1/1  lel-------------------------------------------------------------------
00507291   1/1  may-------------------------------------------------------------------
00516921   1/1  ..drad----------------------------------------------------------------
00474531   1/1  ----------------------------------------------------------------------
00482771   1/1  aaFelngdl-------------------------------------------------------------
00504571   1/1  ----------------------------------------------------------------------