[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55303.1


[Show Plain Result]

## Summary of Sequence Search
   1::816
   6::364  6.9e-49 33.3% 0046881 00468811 1/1   uclease H-like                          
   1::176  1.2e-43 39.5% 0052620 00526201 1/1   uclease H-like                          
   1::180    2e-41 42.7% 0050330 00503301 1/1   uclease H-like                          
   6::189  2.3e-40 41.8% 0051245 00512451 1/1   uclease H-like                          
   7::167    2e-39 41.2% 0047514 00475141 1/1   uclease H-like                          
   1::172  3.6e-38 39.0% 0051402 00514021 1/1   uclease H-like                          
   6::173  4.7e-36 40.4% 0047541 00475411 1/1   uclease H-like                          
   7::179  5.1e-36 38.9% 0050648 00506481 1/1   uclease H-like                          
   5::171  9.4e-24 31.0% 0047793 00477931 1/1   uclease H-like                          
 256::767    1e-21 23.3% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
 190::580    1e-15 26.3% 0038151 00381511 1/1   p containing nucleoside triphosphate hy 
 164::581  1.4e-14 28.3% 0038141 00381411 1/1   p containing nucleoside triphosphate hy 
   8::172    5e-14 31.2% 0049562 00495621 1/1   uclease H-like                          
 164::777  5.3e-14 27.4% 0041442 00414421 1/1   p containing nucleoside triphosphate hy 
 172::476  6.6e-13 26.2% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
 262::777  2.2e-12 25.5% 0036318 00363181 1/1   p containing nucleoside triphosphate hy 
 263::764  8.2e-12 27.5% 0038163 00381631 1/1   p containing nucleoside triphosphate hy 
   7::166  9.9e-12 26.7% 0049323 00493231 1/1   uclease H-like                          
 165::490  2.2e-11 25.2% 0051486 00514861 1/1   p containing nucleoside triphosphate hy 
 289::787  3.8e-11 23.3% 0050677 00506771 1/1   p containing nucleoside triphosphate hy 
 220::448  4.1e-11 25.8% 0042553 00425531 1/1   p containing nucleoside triphosphate hy 
 263::775  6.3e-10 26.5% 0037787 00377871 1/1   p containing nucleoside triphosphate hy 
  81::448  1.4e-09 24.2% 0038162 00381621 1/1   p containing nucleoside triphosphate hy 
 242::448    8e-09 25.2% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 262::763  1.2e-08 24.8% 0035849 00358491 1/1   p containing nucleoside triphosphate hy 
 243::488  1.3e-08 29.1% 0050676 00506761 1/1   p containing nucleoside triphosphate hy 
   7::193  1.5e-08 27.3% 0051397 00513971 1/1   uclease H-like                          
 203::448  1.9e-08 26.9% 0050691 00506911 1/1   p containing nucleoside triphosphate hy 
 262::804  1.9e-08 24.2% 0043887 00438871 1/1   p containing nucleoside triphosphate hy 
 217::448  2.3e-08 24.7% 0038740 00387401 1/1   p containing nucleoside triphosphate hy 
 236::448  2.5e-08 28.2% 0044714 00447141 1/1   p containing nucleoside triphosphate hy 
 232::447  3.3e-08 26.3% 0051499 00514991 1/1   p containing nucleoside triphosphate hy 
 267::448  3.6e-08 30.8% 0043258 00432581 1/1   p containing nucleoside triphosphate hy 
 238::448  3.9e-08 30.2% 0049300 00493001 1/1   p containing nucleoside triphosphate hy 
 234::460  4.4e-08 25.2% 0036317 00363171 1/1   p containing nucleoside triphosphate hy 
 237::457  7.6e-08 26.4% 0035848 00358481 1/1   p containing nucleoside triphosphate hy 
   7::172  9.4e-08 28.6% 0048960 00489601 1/1   uclease H-like                          
 264::775  9.9e-08 27.5% 0038741 00387411 1/1   p containing nucleoside triphosphate hy 
 222::448  1.3e-07 29.0% 0053146 00531461 1/1   p containing nucleoside triphosphate hy 
 267::580  1.9e-07 32.6% 0048111 00481111 1/1   p containing nucleoside triphosphate hy 
 256::461  2.1e-07 26.7% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
 227::448  4.5e-07 27.2% 0052855 00528551 1/1   p containing nucleoside triphosphate hy 
   7::172  7.7e-07 25.2% 0050668 00506681 1/1   uclease H-like                          
 267::448  3.3e-06 30.6% 0042088 00420881 1/1   p containing nucleoside triphosphate hy 
 191::467  4.1e-06 23.8% 0052547 00525471 1/1   p containing nucleoside triphosphate hy 
 257::309  4.6e-06 37.7% 0051331 00513311 1/1   p containing nucleoside triphosphate hy 
 229::448  1.5e-05 29.9% 0042720 00427201 1/1   p containing nucleoside triphosphate hy 
 267::359  1.9e-05 34.6% 0043901 00439011 1/1   p containing nucleoside triphosphate hy 
  43::171  2.3e-05 26.3% 0049035 00490351 1/1   uclease H-like                          
   7::165  0.00014 25.7% 0036277 00362771 1/1   uclease H-like                          
   7::172  0.00025 25.9% 0049624 00496241 1/1   uclease H-like                          
 433::777  0.00047 20.5% 0052795 00527951 1/1   p containing nucleoside triphosphate hy 
   1::816


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
00468811   1/1  -----PmrfvvfDlETtGldpekdrIieiaavlvdengeiidepfstlvkpldgvlispeatlitGitde
00526201   1/1  lllldlrlrdlrfvvlDlETtGlnpe.gdriieigavlvdngrlglllivetfhtlvnplegrpippeat
00503301   1/1  akplldrlvvlDlEttgldpkkgglldeiieigavlvdldggeivdtfdllvkperlapispeateihGi
00512451   1/1  -----lllllllltfvvlDlETTGldpegdriieigavlvdgglleglllllsedglllrvvdrfetlvn
00475141   1/1  ------rlvvlDlEttgldpkgllvegdeiieigavlvdgglilgetfdtlvkpgrpisdeatelhGitp
00514021   1/1  mls.dlrlvvlDlEttgldpegdeiieigavvvdldgnvigesfsllvkperdaldpispfatelhgksG
00475411   1/1  -----sdlplsdmrlvvlDlEttgldpegdeiieigavvvdgglnvivetfsllvkpgrpilpllspfat
00506481   1/1  ------nlvvlDlEttgldpktdlriieiaavlvdggli...fdtlvkpgreisdeatelhGitpedlad
00477931   1/1  ----plllddyelidtleeleelleelldakvvalDtEttgldpyrgrivliqlatgdgeavlinpgh..
00520041   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00495621   1/1  -------ilvfDiETtgllpegdriieigavdlldd...........................eefleda
00414421   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00493231   1/1  ------rvlsfDIEtvtgleggfPdpekdedeiisIslv..ydggedeivlrlvfplgecale......i
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ------kvvalDtEttgldpyrgrlvliqlatggeaylidllhlgd........................
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  ----------------------------------------------------------------------
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ------kvlsfDIEttsngfpdpekdeiisIslvvydggevftlgnpdldp..................v
00387411   1/1  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ------rvlsfDIEttgngfpdpekdeiisIslv.vddgftlitlinrdglp.................v
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ------------------------------------------tettgldpmtadlvglalalggyvplah
00362771   1/1  ------tvlsfDIEttglggkfPdadeIisIslvvyddg..................klitlgeiddvdv
00496241   1/1  ------rvlsfDIEttglgfpdpekdeiisIslvvyddgkvftlgnpelligd.................
00527951   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
00468811   1/1  mladaplfeyevlkefleflkkpgailvghNainFDlpfLrkefkrlglppyltnrllgnsviDtlelar
00526201   1/1  eihGitdemlladappfeevlpefleflrkllkelglggavlvahnasFDlgfLnaelkrlglklplfls
00503301   1/1  tpedladapsfaevlkelleflkgllvdpgkailvghnasfDlrlflrrelkrlglplpyrfldvidtle
00512451   1/1  PgrpippeateltGitdemladaplfaegldlaevleeflefleggavlVaHNgasFDlpfLraelerlg
00475141   1/1  edladapsfaevleelleflggailvghnasfDlrfLrrelkrlgldlphyrllvdvidtlelarrllpl
00514021   1/1  itpemladapsfaevlaelleflkklvplggavlvghnasfDlrfLraelprlglplpyrvlDtltlarl
00475411   1/1  elhgksgitdemladapsfaevlaelleflkklvplggavlvghnasfDlrfLraelprlglplpyrvlD
00506481   1/1  apsfaevlkelleflkgailvghnasfDlrfLrrelprlgi.ldllvidtlllardlsg.lkslsldala
00477931   1/1  ................tdedladalsldevleaLkelledpgilkvghnakfDlkfLar.l...gielpg
00520041   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00495621   1/1  pdekelllaflellkdadllvghNgagFDlpfLkrrlkllglerpllpplrviDtlvlsrllfpdllald
00414421   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00493231   1/1  dgvtvlvfpsEkelLlaflellldpdilvgyNgdnFDlpyLleRakllgiplsrlgrlkksrdkygniaG
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  ----------------------------------------------------------------------
00381621   1/1  ----------eylpvdllllvslleleeallliklpsdlweklkaklrlileellllelelllle.....
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ......laaLkelledpsilkvghnakfDlkvLardl...gielagv.fDtmlaayllgpglr.hsLdal
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  ----------------------------------------------------------------------
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  lvfdsEkelLlafldlireydpdilvgyNgdnFDlpyLleRakllgiplllgrlgrlpevkggnfsskvk
00387411   1/1  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  evfpsEkelLeaflellreydpdilvgyNgdnFDlpyLlrrakllgiplelgrlkrkllpvkfgirssvk
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  lelgl......edddvlkvghnaKydlvllarr....Gielep.ldDtlLlaylldPg..shglddlaer
00362771   1/1  lifdsEkelLlaflelireldPdvlvgyNgdnFDlpyLlkRakvlgidlplgrlkrsskfggfrktsyin
00496241   1/1  .vfdsEkelLeafldllreydpdilvgyNgdnFDlpyLleRakllgidlrlgrlgkkpkiyggrfnsrvs
00527951   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDL
00468811   1/1  aayrllpgllkwplnekglpsykLealakalgiplegaHrAldDaeataellklllkk...lp.klleyl
00526201   1/1  npvlDtltlarlllp...sykldalckrlgidlegr----------------------------------
00503301   1/1  larrlyplglkslsLdalakrlgipiqgraHrAldDarat------------------------------
00512451   1/1  lplpldlpvlDtlvlarrllkllslllrlpglksysLdalakrllgipl---------------------
00475141   1/1  .kslsLdalakllgiplqgaelHrAld-------------------------------------------
00514021   1/1  llpllpslll.......giplegaHrAldDal--------------------------------------
00475411   1/1  tltlarlllpllps.......allgiplegaHr-------------------------------------
00506481   1/1  krllglgiplegraHdAleDarataelll.isqkllall-------------------------------
00477931   1/1  pvfDtllaarlldpglkshsLddlaerylgi---------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381511   1/1  -------------------------------------------------lllillelllalarllleell
00381411   1/1  -----------------------lllgelvllklklkellrelleil.......................
00495621   1/1  lglpgkllgshsLealgerlgilkgeledgfv--------------------------------------
00414421   1/1  -----------------------llvedvdlsllllleelllkklklledrelkkllklvkqineleddl
00527961   1/1  -------------------------------Likkllkdllilllklgellleallellleellllalll
00363181   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00493231   1/1  rhlDllrllrrlsyslyalglk.les--------------------------------------------
00514861   1/1  ------------------------ldgdlaellealldllieelerlllglllkrelldllrlpdlflll
00506771   1/1  ----------------------------------------------------------------------
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  ----------------------------------------------------------------------
00381621   1/1  .......................llrllisfedlglleelleelkell......................
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  aerylgveldkgeqlsdwsarplseeqleyaalDalallrlyekllelleeeg-----------------
00506911   1/1  --------------------------------------------------------------lllllell
00438871   1/1  ----------------------------------------------------------------------
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ipGrlhlDllrllrrll.klpsysLdtvakhl--------------------------------------
00387411   1/1  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ipGrlhlDlldllrrll.klesysLdavakhl--------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  --------------------------------------------------deelldalkrllleelllla
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ylgheli..yaaedAlvtlrLlevlkprLee---------------------------------------
00362771   1/1  isGrlhlDlyrllkrllk.lpsykL---------------------------------------------
00496241   1/1  ipGrlhlDllrllrrll.klpsysLdtvakhl--------------------------------------
00527951   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VQVQGLYFKKTAASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
00468811   1/1  lkllnklsvlell.........................................................
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  ---------------------------------------------iipallsgrdvvllaaptGsGKTla
00381511   1/1  ldllkldlilpeesfeelgldpellealkkgffeltpiQkeaipailk....grdlllvapTGsGKTlaa
00381411   1/1  ..lelealrkplesfedlglpelllealkklgfeltpiQkeaipail....kgedvllvapTGsGKTlaa
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  aelsdeelkaktlelklrladlvpgelldflllelsaellealkrllffrltpiQleaipallsgr...l
00527961   1/1  lellelleklllflllllpelleel..lkllgfelrpyQleaieal...legr.dvllagptGsGKTlva
00363181   1/1  ---------------------------------------------------egkdvllvapTGsGKTlva
00381631   1/1  ----------------------------------------------------grdvllaapTGsGKTlaa
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  elpellpf.........................elrpyQleavnwllervldlllgkgrgglladetGsG
00506771   1/1  ----------------------------------------------------------------------
00425531   1/1  ---------ksfeelglseellkalkk..lgflkptpiQaeaipaile....grdvlvqapTGsGKTlaf
00377871   1/1  ----------------------------------------------------grdvllvaptgsgKtla.
00381621   1/1  ...............................plkltpiQkeaipelleglesgkpknvllagptGsGKTl
00503561   1/1  -------------------------------kPydrLldivgigfltaddialalgiagdsperlllala
00358491   1/1  ---------------------------------------------------sgrdvlvvapTGsGKTlaa
00506761   1/1  --------------------------------lllelgflelrpyQleaipalle....g.dvllaaptG
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ilvegllvptpllsfeelglspellealkklgfekptpiQaeaipaile...grdvlvvapTGsGKTlaf
00438871   1/1  ---------------------------------------------------sgrdvlvvaptgsgktllf
00387401   1/1  ------epllsfeelglseellealkk..lgflkptpiQleaipai...legdrdvlvvapTGsGKTlaa
00447141   1/1  -------------------------pvlsfeelglseellkalkklgfleptpiQaeaipailegrdvlv
00514991   1/1  ---------------------lellid.lglpfelrpyQleaveallellekgrgglladptGsGKTlva
00432581   1/1  --------------------------------------------------------llvapTGsGKTlva
00493001   1/1  ---------------------------lsfedlglseellkalkelgfekptpiQaeaipailegrdvlv
00363171   1/1  -----------------------ikplklispfeprpyQqeaiealleglekgkknvllvgptGtGKTlt
00358481   1/1  --------------------------lkalgpfeltpiQqeaipaileglesgprdvllvgptGtGKTlt
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  -----------------------------------------------------rdvlvqaptgsgktl.k
00531461   1/1  -----------elllllvllsdlplpllsfedlglseellkalkklgfekptpiQaeaipailegrdvlv
00481111   1/1  --------------------------------------------------------laqapTGsGKTlaa
00348321   1/1  ---------------------------------------------ilealrsgrvvllvgptGsGKTtla
00528551   1/1  ----------------lvegldlplpllsfedlglspellealkklgfekptpiQaeaipailegrdvlv
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  --------------------------------------------------------lvvapTGsGKTlay
00525471   1/1  lelllllalldllsfeelgldeellealkklgffelrpyQleaipallegresglpmdvllaaptGsGKT
00513311   1/1  ----------------------------------------------elalesgrdvllvaptGsGKTlaa
00427201   1/1  ------------------llselllpvlsfedlglseellkalkklgfeeptpiQaeaipailegrdvlv
00439011   1/1  --------------------------------------------------------llqapTGsGKTlaf
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLF
00468811   1/1  .........................klelykifllvsnffgkkklyklvslpllkhpyyknwiivfdLrl
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  allpilelllegggrvlvlaPtralaeqvaeelr....................................
00381511   1/1  llpalelllkgk..rvlvlaPtrelaeqiaeelrkllgflgldlelkvallhg.................
00381411   1/1  llpaleallkgk..rvlvlaptrelaeqiaeelrkllge.lggdlklkvallhgglslke..........
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  leapTGsGKTlaallpallallngkgvlvitPtreLaeqiaeelrellkf.lglkvglltgglslke...
00527961   1/1  lllilel..gkrvlvlaPtraLaeqwaeel.kflg....lklvglltgglslke................
00363181   1/1  llpallrllekgkrvlvlvptrelalqlaeelkkl...................................
00381631   1/1  llpilllllrgk..rvlvlaPtreLaeqiaeelkkllg................................
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  KTlvalllilelllrgklkgplakrvlvvvPt.sLaeqwleefkkffpgl..lkvlvltgglsakerkel
00506771   1/1  --------kgkralvlaPtreLalqiveelkkllpllglglrvallvggtslk.................
00425531   1/1  llpileallkllkggkalvfaptrelaeqlaeel.rklgkelglllgikvallhgglsqke.........
00377871   1/1  llpllaklkggrvlvlaptrelaeqlaellk.......................................
00381621   1/1  vallailelllrgkqvlvlvPtralaeqlaeefkklfgll.glrvgllhgglskkereeileklrs....
00503561   1/1  llsellgeghlylplddlveellklleldelllelieleellkelleeilvellkedlelvlderrlyle
00358491   1/1  llpalllllalgk..qvlvlvPtr..............................................
00506761   1/1  sGKTlaallpilelllrggk..rvlvlvPtrelaeqwaeelrkllgl.......................
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  llpilqlllklllllllllklkgpralilaPtreLalqiaeelkkllkll.glrvalltggtsld.....
00438871   1/1  llpall..kggrvlvltptrelaeqlaevlrk......................................
00387401   1/1  llpllelllkepggkvlvfvptrelaeqlaerlkkllk.llglkvgllhgglsqker.............
00447141   1/1  vapTGsGKTlafllpllelllkepkggkalvfvptrelaeqlaevlrkllklllgikvallhg.......
00514991   1/1  lllilellergpakrvlvvvP.rslaeqwaeelkkfl...pglkvgvltgglkl................
00432581   1/1  llailellerng.kkvlvlvPtraLaeqiaeelkklfgil.glkvavltgglskker......lrgd...
00493001   1/1  qapTGsGKTlafllpilllllkepkgpralvlaptrelalqiaevlrkllkll.glrvalltg.......
00363171   1/1  aaalaael..gkpvlivaptkeladqlyee....lkkllpelkvellhggldylqkealfpeidtlpykd
00358481   1/1  aaalalel..gkqvlvlaptrelaeqlaee....lrelfpelpvilfldeidalpperlspssdviirva
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  llpllelllekggrvlvfvptrelaeqlaellrkl.......gik.........................
00531461   1/1  qapTGsGKTlafllpilqlllklpkgpralvlaPtrelalqiaeelkkllkll.girvalltgglsik..
00481111   1/1  llpallall..agkqvlvvtptreLaeqva.evlkklleflglsvglltgglslkerrlag.........
00348321   1/1  lalalel..ggrvlvlvptralaeqlaerlakllglrvgllvgylirfestr..................
00528551   1/1  qapTGsGKTlafllpilqlllklpkgpralvlaPtrelalqiaeelkkllkll.glrvall.........
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  llpall..rggkvlvfvptrelaeqlaeelrkl.....girvallhgglsqeerervleafrsg......
00525471   1/1  lvallailelllrgk..rvlvlvPtrelaeqwaeelkkllpel.glkvallhgglsqkereealekfksg
00513311   1/1  llpilellllrggrvlvlaPtrelalqva-----------------------------------------
00427201   1/1  qapTGsGKTlafllpllelllkllkggqalvfvptrelaeqlaeelrkllkll.gikvallhgglsqker
00439011   1/1  llpilqlllkklkggqvlifvptrelaeqlaevlrellkflpglkvallhgglsqker............
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH
00468811   1/1  dpegllnlsigeLk--------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  ...............................................gltggervrllerllsgeadilv
00381511   1/1  ...........................................................glslkereeal
00381411   1/1  .............................................................reealerfg
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00527961   1/1  ................................................................divitT
00363181   1/1  ......................................................................
00381631   1/1  ......................................................................
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  leklasgepllka.........................................................
00506771   1/1  ......................................................erleilkkllsgadil
00425531   1/1  ..............................................................rlralkgk
00377871   1/1  ......................................................................
00381621   1/1  ...............................................................geadilv
00503561   1/1  eleldelglaellkelleeleideklldkilddlegilplnpeQkeaieail....kgrvvliqGppGtG
00358491   1/1  ......................................................................
00506761   1/1  ...................................................lglkvglltgglslkerle
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ..................................................................eqir
00438871   1/1  ......................................................................
00387401   1/1  ...........................................................lralgkadilv
00447141   1/1  ................................................................glsqee
00514991   1/1  ............................................................lllgkadivi
00432581   1/1  .................................................................adivv
00493001   1/1  ................................................................glslke
00363171   1/1  aspneeidlerlsallallegepd..............................................
00358481   1/1  llhgglseaerlealralle..................................................
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  ......................................................................
00531461   1/1  .....................................................................e
00481111   1/1  ................................................................gadivv
00348321   1/1  ................................................................ilvvty
00528551   1/1  ........................................................tgglslkerleall
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  .............................................................kadilvaTp
00525471   1/1  ead...................................................................
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ......................................................................
00439011   1/1  leafkkgkv-------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQETYDIQSIIDLIDKALVGEENRVQQRILESIRFE
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  gtpgrlldlllrdlllrnldlviiDEahrldlgfgpllrlllellpr.......................
00381511   1/1  edlgeadilvaTpgrlldllrd...lknldlvilDEahrlldeqrgpllelllmgf..............
00381411   1/1  eadilvaTpgrlldgldr...lknldlviiDEahrlldsqrgpllellllgf..................
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  rrlaggadilvgTpgrllddllrdnlalslgllvlrnldllviDEahrllv....degfrplilsi....
00527961   1/1  pgrlldlldlllk..nldlviiDEaHrlln...sqlkkilkrlpdlqvlllsATpi--------------
00363181   1/1  ......................................................................
00381631   1/1  ......................................................................
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ......divittyqlllkdlef.lslrnldlviiDEaHrlknfgsklrkalkrlkaarrlllTATPiqnn
00506771   1/1  vaTpgrlldlle....lsnldllviDEaH.........................................
00425531   1/1  adilvaTpgrllddlaargldlpnvdlv------------------------------------------
00377871   1/1  ......................................................................
00381621   1/1  gTpellfdllr....lknlglviiDEah------------------------------------------
00503561   1/1  KTtlalaliaellkelkgkgkrilvlap------------------------------------------
00358491   1/1  ......................................................................
00506761   1/1  alggadilvttpgrlldlllrdllllsnldlvilDEaHrlldlgfgplllkilrrlrpdlrvlllsAT--
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  alkkgpdilvaTpgrlldllrrgkldls------------------------------------------
00438871   1/1  ......................................................................
00387401   1/1  aTpgrllddlaargldlpnvdlvilDea------------------------------------------
00447141   1/1  rlrvlkgkvdilvaTpgrllddlaargl------------------------------------------
00514991   1/1  ttyelllrllelknl..kfdlviiDEa-------------------------------------------
00432581   1/1  aTperldsllrrl..lddlglviiDEaH------------------------------------------
00493001   1/1  rlralkggadilvaTpgrlldlllrrgl------------------------------------------
00363171   1/1  ......................ivvatvqalld..lpkpe------------------------------
00358481   1/1  .................geadilvaTvgrlldlldpa---------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  ......................................................................
00531461   1/1  rlralkggadilvaTpgrlldlllrgll------------------------------------------
00481111   1/1  gTpgrllddylrdnhllrqedlvlrnlsllviDEaDrllddgfrtlliiilk..................
00348321   1/1  glllrll..dlllsdfdliiiDEahelsaetdlllglllel-----------------------------
00528551   1/1  .....rggadilvaTpgrlldllrrgll------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  grllddllargldlpdvdlvilDEahrl------------------------------------------
00525471   1/1  ilvaTpgrll....rgldlpnldlviiDEahrlgfrdlaqllgrlpr-----------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ..leilgkvdilvaTpgrllddlaargl------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  ------------lsnlgllvlDEahrlldgfgpqlr..................................


                         *         -         -         -         -         +         -:560
query           CLYLIEQFQSGKSRKNILDSLDNLHQYFSELEVEGFDELVRYFTAEGDYWLEVTETSQKKIQISSTKSGR
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  ......................................................................
00381511   1/1  ......................................................................
00381411   1/1  ......................................................................
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  ......................................................................
00381631   1/1  ......................................................................
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  ..................................................................rlld
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  ......................................................................
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ......................................................................
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  ......................................................................
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  ......................................................................
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ......................................................................
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  ......................................................................


                         -         -         -         *         -         -         -:630
query           TLLSSLLPESCQVLGVSATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYA
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  ...........pdlqllllSATpppe...............................eltlpllrldvll
00381511   1/1  .........lsqlreilral--------------------------------------------------
00381411   1/1  .....lsqlreilralppdvq-------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  ......................................................................
00381631   1/1  ......................................................................
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  mgfrkllrrl..pdrqvlllsATpipnvlelllsllgllv......pdllkqfvlvvlkee.........
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  ......................................................................
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ......................................................................
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  ......................................................................
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  ......................................................................
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ....................--------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  .kilellpkarqvlllsATpirevlllallllldpvvievl............pelikqvvlvvpssgkl


                         -         +         -         -         -         -         *:700
query           REVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  veeslklelllellelllelggkvlvfvnsreeaellaellrelgikvlvlhgglsqeereevle.geik
00381511   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  .................................gikvavlhgdlsqkereeiledfrngeidvLvatdvl
00381631   1/1  .........................aeelaellkgikvallhgglsqeereevleafrsgeidvLvaTdv
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  ..kleallellkellalgrggkvlvfvntrktaellaelLrelgikvaalhgllssssllglsqeereei
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  .............................elgikvavlhgglsqeereeilerfrsgeikvlvaTdvler
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  .....................ktaeelaellre.lgikvaalhgdlsqeereeiledfrngeidvLvatd
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  ..............................lgikvavlhgglsqeereeileafrngeidvLvaTdvlgr
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  ....................................vavlhgglsqeereevleafrsgkidvLvaTdvl
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  eallellkel.kgkqvlvfvntrelaeqlaellgvallhgdlsqkereeiledfrngeidvLvatdvler


                         -         -         -         -         +         -         -:770
query           GVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSL
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  vlvatdvlerGlDi.dvdlViiydlvkldvllldldlgl............vllllrplslasyiQr---
00381511   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  ............................................................vdtvinydlp
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  arGlDipnvdlViildlpkl...........................llllslelyiQriGRagRagkkg
00381631   1/1  lerGlDipdvdlViiydl................................pkslesylQrirGR------
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  ledfrngeidvLvatdvlerGlDipdvdlvinydlpk................................s
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  GlDipdvdlViiydl................................pkslasyiQriGRagRagqkglv
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  vlarGlDipdvdlvinldlpkllllq...........................slelyiQriG-------
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  GldipdvdlVinydlpk................................spesyiQriGRagRagqkgla
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  grGidlpdvdlViiydl................................pkspesyiQriGRagRagqkg
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  GiDipdvdlvinldlpk................................slesyvQriGRagRagkkgla


                         -         -         *         -         -         -         -:840
query           TLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIDRFFNEL------------------------
00468811   1/1  ----------------------------------------------------------------------
00526201   1/1  ----------------------------------------------------------------------
00503301   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00475141   1/1  ----------------------------------------------------------------------
00514021   1/1  ----------------------------------------------------------------------
00475411   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00414421   1/1  nsledyl---------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00363181   1/1  laillvt---------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00506771   1/1  lasyiQriGRagRagkg-----------------------------------------------------
00425531   1/1  ----------------------------------------------------------------------
00377871   1/1  illld-----------------------------------------------------------------
00381621   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00438871   1/1  illlspedllllralielllgkklalldlelrgi------------------------------------
00387401   1/1  ----------------------------------------------------------------------
00447141   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00358481   1/1  ----------------------------------------------------------------------
00489601   1/1  ----------------------------------------------------------------------
00387411   1/1  laill-----------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00506681   1/1  ----------------------------------------------------------------------
00420881   1/1  ----------------------------------------------------------------------
00525471   1/1  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00427201   1/1  ----------------------------------------------------------------------
00439011   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00362771   1/1  ----------------------------------------------------------------------
00496241   1/1  ----------------------------------------------------------------------
00527951   1/1  illvdpd---------------------------------------------------------------