[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55326.1


[Show Plain Result]

## Summary of Sequence Search
   1::121
   1::121  4.6e-16 29.5% 0048855 00488551 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  8.1e-16 27.8% 0048209 00482091 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  5.8e-15 24.8% 0048208 00482081 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121    6e-15 27.0% 0047830 00478301 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  2.6e-14 28.1% 0051634 00516341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::122  3.2e-14 26.7% 0046683 00466831 1/1   alase/Bleomycin resistance protein/Dihy 
   2::122  5.3e-14 24.1% 0047894 00478941 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121    2e-13 25.2% 0047984 00479841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::120  3.3e-13 28.4% 0049036 00490361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  4.4e-13 27.8% 0048964 00489641 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121    1e-12 25.4% 0046737 00467371 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  1.1e-12 25.2% 0052095 00520951 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  1.4e-12 27.1% 0048412 00484121 1/1   alase/Bleomycin resistance protein/Dihy 
   1::118  1.7e-12 24.5% 0051065 00510651 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  2.5e-12 21.7% 0046682 00466821 1/1   alase/Bleomycin resistance protein/Dihy 
   1::119  4.9e-12 27.5% 0046043 00460431 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  8.4e-12 25.2% 0047893 00478931 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  5.2e-11 26.3% 0049725 00497251 1/1   alase/Bleomycin resistance protein/Dihy 
   2::120  1.3e-10 28.3% 0047558 00475581 1/1   alase/Bleomycin resistance protein/Dihy 
   1::120  2.5e-10 28.3% 0049683 00496831 1/1   alase/Bleomycin resistance protein/Dihy 
   3::123    3e-10 28.1% 0049803 00498031 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  1.1e-09 27.6% 0049443 00494431 1/1   alase/Bleomycin resistance protein/Dihy 
   2::120  1.6e-09 23.4% 0048015 00480151 1/1   alase/Bleomycin resistance protein/Dihy 
   2::118  3.3e-09 21.6% 0046684 00466841 1/1   alase/Bleomycin resistance protein/Dihy 
   2::119    1e-08 24.8% 0043737 00437371 1/1   alase/Bleomycin resistance protein/Dihy 
   2::120    2e-08 25.9% 0051635 00516351 1/1   alase/Bleomycin resistance protein/Dihy 
   2::118  1.2e-07 20.9% 0047985 00479851 1/1   alase/Bleomycin resistance protein/Dihy 
   2::119  7.5e-07 23.5% 0049535 00495351 1/1   alase/Bleomycin resistance protein/Dihy 
   2::118  8.3e-07 29.8% 0051145 00511451 1/1   alase/Bleomycin resistance protein/Dihy 
   1::119  1.1e-06 25.9% 0049133 00491331 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121  5.5e-06 26.3% 0046521 00465211 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  7.2e-06 22.4% 0049534 00495341 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  6.2e-05 24.8% 0049435 00494351 1/1   alase/Bleomycin resistance protein/Dihy 
   2::121  0.00087 25.0% 0049436 00494361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::121


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAEN
00488551   1/1  mmimgldhvvlpvpDleaalaFYtd.L...Gfevverfpdpdggvyyaflrl..ggahlelalapagggg
00482091   1/1  MgitgldhvvlrvsDleaalaFYtdv...LGfelvertddpdggvtyaflrlggggielalfegpggggl
00482081   1/1  mmmgitglghvvlrvsDleaalaFYtdv...LGfelvdrgddgvaflrlgdgglvlalvlppagggglhh
00478301   1/1  MgldhvalpvsDleaalaFYtd.L...Gfelvdrtddggyaflrlgggavlelllppdgespiakflpag
00516341   1/1  MtgilgldhvalrvsDleaalaFYtdv...LGfelvdrvpdlddggvtlaflglggggiglaltlppgpe
00466831   1/1  GmimgldhvvlpvsDleaalaFYtd.L...Gfelvertpdpdggvtyaflrlggthlelalap.gpepgl
00478941   1/1  -msgppmgimgldhvvlrvsDleaalaFYtdv...LGfelvdrfvleglddggvrlaflrlggghlelal
00479841   1/1  -SimglghvalrvsDleaalaFYtdvL...Gfelvdrtd.glaflrlgggglelalt.papgpglhhlaf
00490361   1/1  MikilglhvalpvsDleaalaFYtdvL...Gfelvergdd.yaflrlggavlelalapgpepaaavhlaf
00489641   1/1  nglllellldlllpasepmmilgidhvalpvsDleaaaaFYtdvLGfelvervdfpdggfrlaflrlggg
00467371   1/1  mgldhvvlrvsDleaalaFYtdvL...Gfelverfdledggvgyaflrlgggahglvlelfeppdgapap
00520951   1/1  -pmgldhvvlrvsDleaalaFYtdvLGfelvervddpdggvgyaflrlgggadghvlelteppdpappph
00484121   1/1  milgldhvvlpvsDleaalaFYtdv...LGfelvdrgdd.yaflrlgg..thlelalapgpdppdagggg
00510651   1/1  mmglghvvlrvsdleaalaFYtdvL...Gfelvdrddglaflrlgdgglvlalvppapagggglvhlafe
00466821   1/1  -lplpaspvpapmgimglghvvlrvsDleaalaFYtdv...LGfelvdrgggyaflrlgd.ggavlelal
00460431   1/1  vmmilgldhvalpvsDleaalaFYtdv...LGfelvdrgdd.yaflrlggtvlelalapgpeppglvhla
00478931   1/1  -pimglghvvlrvsDleaalaFYtdv...LGfelvdrdd.gyaflrlggghlelalvpgp.ggglvhlaf
00497251   1/1  kmmsvmglmgi.hvalrvsDleaalaFYtdvLGfelvdrfddpdgfgyaflrlggggivlalteapdgap
00475581   1/1  -mkpmilgldhvalavsDleaalaFYtdvLGfelvarvdledggvrlaflglavlaglggirlelleppg
00496831   1/1  MkmkllhiaLrvdgdleealaFYtdvL.gfelvrrvpdpggaflglgggvllalltlgglalmasdggpd
00498031   1/1  --lliihvaLrvdgdleealaFYtdvLGfellrrldfpeagaftlvflglgggvlhaeltlggtllllld
00494431   1/1  gplpnpmgllgidhvalavsDleaalaFYtdvLGfelvarvdledggfglaflal..gdggirleltepl
00480151   1/1  -mitgldHvvlrVsDleaslaFYrdv...LGfrlvertdglaflrlggghlllllllleapg..ggglgh
00466841   1/1  -vlprpllpmmgilrlghvvlrvsDlekaraFYtdvL...Glevvdrdeglvflrlggggdhhslalteg
00437371   1/1  -MknpvmllrldhvalavsdleraiaFYedLGfevvaredddgeltllllglpgggvrvaflrlgggeir
00516351   1/1  -lplllalmmitglghvtlrVsdleealaFYtdvL...Glelvkrtdnyhlflgaggghhglalfewpga
00479851   1/1  -rvslrvmgilglghvvlrvpDldkalaFYtdvLGfelvdrvddlllpgggfrlaflrlggdhhslalvp
00495351   1/1  -pmgllgidhvvlalavgdldaalafYtdvLGfelvarfrdldvegpeggfrsaflrlpdggirleLtep
00511451   1/1  -gmmltkigrmlhvgvldved...alaFYtdvLGfelvrrfdfpdappgglaggvtlaflglg.gstlal
00491331   1/1  MilgldhvvlavsdleaaaafytdvLGfelvervddetggtalsaflrlggtrlelllpedpeppgvhhi
00465211   1/1  mkllhvvlpvkdleaslaFY.elL...Gfevvfrfddyaflrlgglvlelleapgdppggggvhlafevd
00495341   1/1  -nplgllgldhvvlavgdleaaaafYtdvlGfelvarhdsedgkvalavlllrqggivlelneplgedgp
00494351   1/1  -manpmgllgidHvalaVpDleaalaFYtdvLGfelvayfdskdvetpeggfrsaflrlpgggirleLte
00494361   1/1  -mslpalpnpmgilgldhvglavpDleaalafYtdv...LGfelvarveledggtslaflglglgdirle


                         -         -         *         -         -         -         -:140
query           KEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE-------------------
00488551   1/1  lhhlafevdsredldaalarlkaaGvpaevlgep...gdhgpgggrsayfr-------------------
00482091   1/1  hhlafevddldaldaavarlraaGvevlgepg...dhpggggrsayfrDPd-------------------
00482081   1/1  lafevpsrddldaavarlkaaGvevlrepgdrpygs.grsayfrDPdGnli-------------------
00478301   1/1  ggglvhlafevdsrddldaavarlkaaGvevlgepgdrpgg..grsayfrD-------------------
00516341   1/1  appaalgggglhhlafevddldaldallarlkaaGvevl.epg...drpgg-------------------
00466831   1/1  hhlafevdsredldaavarlkaaGvrlevlrgpgdhpggg.grsayfrDPdG------------------
00478941   1/1  apgpgggglhhlafevddldaldaalarlkaaGvevlgpprdgpgg..grsa------------------
00479841   1/1  evdsrddldaalarlkaaGvevlgepgdrpggrrvfysayfrDPdGnliel-------------------
00490361   1/1  evddldavlarldrllaaGvtiliepgvrepgdhpggrsayfrDPdGnli--------------------
00489641   1/1  vhdpldlllivalalsggtvlelteapgpeppsqilaplgnlggvglhhla-------------------
00467371   1/1  pgpglhhlafevdd...ldaavarlkaaGvevleepgdhpggg.vrsayfr-------------------
00520951   1/1  gtglhhlafevdd...ldaavarlkaaGvevleep......gggrsayfrD-------------------
00484121   1/1  lhhlafevds.edldaavarlkaaGvevleep.....pgggrsayfrDPdG-------------------
00510651   1/1  vpsrddldaalarllaaGvtvleep.....pgggrsayfrDPdGnlie----------------------
00466821   1/1  ppgpepglhhlafevpsrddldaavarlkaaGvevlrgpgdhp.yGvgrsa-------------------
00460431   1/1  fevdd...ldaalarlkalglellalaGvevlgepg...drpggrsayf---------------------
00478931   1/1  evpsrddldaalarlkaaGvevlggpgdrpggrrvlysayfrDPdGnliel-------------------
00497251   1/1  aaagpglhhlafevddreeldaavarlkaaGvevvgepgd...pgggrsay-------------------
00475581   1/1  pespiaefldkhggpvglhhiafrvdd...vdaavarlkaaGvevlgepg--------------------
00496831   1/1  agg..gvhlalevddreevdalyerllaaG.tvvmppt...dtpwggrfa--------------------
00498031   1/1  agpeeppea..gggvhlafsvddvdevda.yarllaaGgevlmpptdtpwg..-----------------
00494431   1/1  gepdspaaefldkhgpgvhhlafrvdD...vdaavarlraaGveilgepvr-------------------
00480151   1/1  lafsvddldaalarlraagvevlegpvd...rgggrslyfrDPdGnliEl--------------------
00466841   1/1  pap..glahlafevdsrddldaaaarlraaGvevlrgpgd.hepgggr----------------------
00437371   1/1  lelleppdpdsaiaeflakphggglvhlafevdD...idaavarlraaG---------------------
00516351   1/1  paprpgtgglhHlafrvddredldaalerlkaaGvpvl....gpvdhggg--------------------
00479851   1/1  gpepgglhhlafevddlddldaaadrleaaGvevlgpprhg..pgggr----------------------
00495351   1/1  lgpdgrspiaeflekhlgpgvqhiafrvdD...idaavarlkaaGvevl---------------------
00511451   1/1  leapdggpapagnpgvglvhlafevdd...vdaavarlkaaGgvevlg----------------------
00491331   1/1  afrvdd.edldaaverlkaaGvevlgep..iregdggrvfyfrdpdgnl---------------------
00465211   1/1  d...vdaayarlkaaGvevllepvlrltepvdepwggreayvrDPdGnlle-------------------
00495341   1/1  aasqiaeflaah.gpgvqhialrvdD...vdaavarlvaaGaevleppady-------------------
00494351   1/1  plgteddpsqiaeflekhlgpGvqhiafrvdD...idaaverlraagllgG-------------------
00494361   1/1  llappdpgpvlelthnlgvesldlldlspaaaflerhgpglahiafrVdd.-------------------