[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55344.1


[Show Plain Result]

## Summary of Sequence Search
   1::238
  70::230  3.9e-33 32.7% 0035809 00358091 1/1   ATP synthase subunit A                  
   1::238


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGS
00358091   1/1  ---------------------------------------------------------------------g


                         -         -         *         -         -         -         -:140
query           RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
00358091   1/1  kkgkkfapllltlflfilllnllgllPyvflllllllllglllllvsptsdlvvtlslalpvflllillg


                         +         -         -         -         -         *         -:210
query           KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
00358091   1/1  ikkkgllgyllslllplgtplllipllvlielisllirplsLslRLfaNilAGhllllllallllll...


                         -         -         -         +         -         -         -:280
query           VFISCIQAYVFTLLTSVYLGNKINIEEE------------------------------------------
00358091   1/1  ..llllllllllllelfval--------------------------------------------------