[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55442.1


[Show Plain Result]

## Summary of Sequence Search
   1::160
   4::81   5.6e-25 52.6% 0047044 00470441 1/1   transcript cleavage protein, N-terminal 
   4::79   1.4e-23 53.3% 0052572 00525721 1/1   transcript cleavage protein, N-terminal 
  81::159  1.8e-19 41.8% 0038237 00382371 1/1   like                                    
  82::158  1.3e-18 41.6% 0052573 00525731 1/1   like                                    
  82::158  1.6e-18 41.6% 0052517 00525171 1/1   like                                    
   1::160


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKTYPMTLEEKEKLEKELEELKLVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
00470441   1/1  ---kklllTlegleklkeelellktverpeiveaiaeArelGDlsENaeYhaakeeqrliegrireLekl
00525721   1/1  ---ekvlltkegyekleeelellk.verpeiieeiaearelGdlsEnaeYdaakeeqgliegrireLedl
00382371   1/1  ----------------------------------------------------------------------
00525731   1/1  ----------------------------------------------------------------------
00525171   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
00470441   1/1  lenaevidlsk-----------------------------------------------------------
00525721   1/1  lsnaeiidp-------------------------------------------------------------
00382371   1/1  ----------plpsdvvtfgstVtlldlddgeevtytlvgpdeadlkaglisvlsPlgraLlgkkvgdev
00525731   1/1  -----------ldddvvtfgstVtlldlddgeeltytlvgpdeadlkkglllisvlsPlgraLlgkkvGd
00525171   1/1  -----------ldddvvtlgstVtlldlddgeeltytlvgpdeadlkkglllisvlsPlgraLlgkkvGd


                         +         -         -         -         -         *         -:210
query           TIETPVGSYDVKILKVEKTA--------------------------------------------------
00470441   1/1  ----------------------------------------------------------------------
00525721   1/1  ----------------------------------------------------------------------
00382371   1/1  evtlpggeleveileveyq---------------------------------------------------
00525731   1/1  evevelpgglleleilev----------------------------------------------------
00525171   1/1  evevelpgglleleilev----------------------------------------------------