[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55485.1


[Show Plain Result]

## Summary of Sequence Search
   1::347
   7::340  6.2e-48 27.0% 0053131 00531311 1/1   lycosyltransferase/glycogen phosphoryla 
   7::340  2.6e-41 26.1% 0051981 00519811 1/1   lycosyltransferase/glycogen phosphoryla 
  50::340  6.6e-38 27.6% 0043452 00434521 1/1   lycosyltransferase/glycogen phosphoryla 
 143::321  4.6e-23 31.1% 0052623 00526231 1/1   lycosyltransferase/glycogen phosphoryla 
  38::341  5.1e-22 22.8% 0038341 00383411 1/1   lycosyltransferase/glycogen phosphoryla 
 108::341  5.3e-20 21.0% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
   1::347


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKKKLRINMLSSSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTIDFPYYLSTFQK
00531311   1/1  ------kIllvtpslpp.vgGvervvlelaralakrghevtvltpggggllepgvrvvrlpllrlplllr
00519811   1/1  ------mkiililevapppkvGGaervvlelaraLakrGhevtvitpgyggllpllellvivvvllllll
00434521   1/1  -------------------------------------------------kpDvvhahdwhsglaalllkl
00526231   1/1  ----------------------------------------------------------------------
00383411   1/1  -------------------------------------srlivvsnrlPvklvrkrgagglvsalsdlled
00467161   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIP
00531311   1/1  llllllrlrrllrrlkpDvvhahsplpgllallaarllgiplvvtlhgllpll.....lpgllsrllrll
00519811   1/1  glvllllllvllvllllllllllllrplllllldllllllllalllllalllrrekpDivhahdwlpgll
00434521   1/1  arllgiplvltiHglafqglfpllllsllglpallfglagllrrllrnllraalrradrviavSetyaee
00526231   1/1  ----------------------------------------------------------------------
00383411   1/1  lgglwvgwlgivvdeeeelllellggydlvpvflsdedfdgyYngfaneiLWPlfhylldlplfdrsswa
00467161   1/1  -------------------------------------idrladlhfapsefarenllkegipperifvvg


                         +         -         -         -         -         *         -:210
query           NFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
00531311   1/1  lrlllrradaviavsealaeellelygvppekivvipngvdldrfrpapdpelraalrerlglpedkpvi
00519811   1/1  alllarllgipvvltiHgllplglpsllllgllllllllrllrlllrlalrradaviavSeftaeellkl
00434521   1/1  llrlylglglegllgvpaekivvipngvdtdlfnpapdpelpvnysadtlegklenkaalrerlglpddd
00526231   1/1  --vdlerfgp...............dpdkpvilfvgrlvprKgldlllealallpdvklvivGd...gpl
00383411   1/1  aYvrvnrlfAealakllkpgdiiwvhdyhllllpallrellpgapigfflHipfpssevfrilpvreell
00467161   1/1  npvidalfklaekalrppllsrselleklgldpdkkvilvtghrrlnedkglelllealaellerlpdvr


                         -         -         -         +         -         -         -:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
00531311   1/1  lfvGrlvprKgldlllealalllkrlpdvrlvivG........dgplreelealaaelgledrvrflGfv
00519811   1/1  ygvppekivvipnGvdldrfnpapdkllakarlalrrklglppdkpvilfvGRlelprKgldllleAlak
00434521   1/1  kplilfvgRlvpqKgidlllealarllepdvrlvivG...dGp...lreelealaeelglpdrvrflgfv
00526231   1/1  reeleelakllelglednviflgfvsdeelaelyaaadvfvlpslyEgfglvllEAmaaGlpviatdvgg
00383411   1/1  rgllgadligfqtkryarnflsacsrll.gseavkkrivrlygrtvkvtvipigidvdrfapladpevke
00467161   1/1  lvivgh...gntrgrlelikllg..lpdnvrllgplgyldllallaaadlvvtds.....GgvvlEamal


                         -         *         -         -         -         -         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKQAALGRK---
00531311   1/1  s.d.laelyaaadvfvlpSryEgfglvllEAmaaGlPvvatdvgglpevvedgetGllve----------
00519811   1/1  llkkllgpdvklvivG.....dgplreeleklakelgledrvrflGfvsdeelaelyaaa----------
00434521   1/1  sdeelaelyaaadvfvlPSryEgfGlvllEAmacGlPvvasdvgGlpevvedgllynlll----------
00526231   1/1  lpeivedgvtgllvdpdvealaeailrlledpelrrelgea-----------------------------
00383411   1/1  rvrelrgllggkklilgvgrldysKGilllleAferllekypelrgkvvlvqvgvpsredg---------
00467161   1/1  GkPvvvlrdtgerpelvdagtgilvgtdpeaiaeaierllsdpelrermseaanpygdgna---------