[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55561.1


[Show Plain Result]

## Summary of Sequence Search
   1::321
 142::319  5.2e-45 34.3% 0045588 00455881 1/1   reaking-rejoining enzymes               
 147::317    9e-41 34.3% 0034815 00348151 1/1   reaking-rejoining enzymes               
 143::319  7.5e-37 38.1% 0035058 00350581 1/1   reaking-rejoining enzymes               
   1::321


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESKVTIIMQEMLPLLNNEQLLALRESLEHHLVDGKKQQKYSNNNLLQLFITAKQVEGCSSKTIRYYQRT
00455881   1/1  ----------------------------------------------------------------------
00348151   1/1  ----------------------------------------------------------------------
00350581   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IENLFNAIKESVTQLTTDDLRSYLANYQSEKDCSKANLDNIRRILSSFFAWLEQEEYIIKNPIRRIKKIK
00455881   1/1  ----------------------------------------------------------------------
00348151   1/1  ----------------------------------------------------------------------
00350581   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TEQNVKETYTDEHLEIMRDNCENLRDLAIIDLLASTGMRVGELVQLNRSDIDFENRECVVFGKGKKERPV
00455881   1/1  -ekklpraltleelkallaaldnsdsllglrdralllllyatGlRvsEllgLrvkdvdlddgglllirvr
00348151   1/1  ------raltleelkalldaldsltllglrdrallllllltGlRisEllglrwsdidleggtlrvrgKgg
00350581   1/1  --kklprfltleelealldaldsllalrdrallllllltGlRisEllgLrwsdidler.llvvrgKggke


                         -         -         -         +         -         -         -:280
query           YFDARTKIHLRNYLNDRKDSHPALFVTLVGKAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAI
00455881   1/1  rgKgdqegkervvplspelveaLrrylearkllkipdgyLFvslrrngrllgkplsrrsvrrilkraakr
00348151   1/1  kertvplspealelLkrylelrrllllllgdsdylfpsrrg..kplsrstlrralkralkraglplkrlt
00350581   1/1  rtvplspellealkryl.......dylfpsrrgkplt.........lkraakkaglkritpHtlRHtfat


                         -         *         -         -         -         -         +:350
query           DKGMPIEQVQKLLGHSKIDTTLAYAMVNQNNVKHSHQKFIS-----------------------------
00455881   1/1  agidaellededellkrispHslRhtfAthlleaGvdlr-------------------------------
00348151   1/1  pHslRhtfatllleaGvdlrvvqellGHssisttqiY---------------------------------
00350581   1/1  hlleagvdlrvvqellGHssisttliYthllpellreav-------------------------------