[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55614.1


[Show Plain Result]

## Summary of Sequence Search
   1::226
  15::94   3.1e-07 30.8% 0051684 00516841 1/1   domain 2-like                           
   1::226


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
00516841   1/1  --------------hrlaiighrklrllerllsaL.tgipgvgpv.lakaLlehfgsleallaasleeLa


                         -         -         *         -         -         -         -:140
query           SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLNTQNQIIHQ
00516841   1/1  evpgiGpkkaesikdfleepfnle----------------------------------------------


                         +         -         -         -         -         *         -:210
query           QTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
00516841   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VSHSNYFSYREKTDLI------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------