[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55668.1


[Show Plain Result]

## Summary of Sequence Search
   1::362
   1::356  7.8e-86 30.7% 0047653 00476531 1/1   roquinate synthase-like                 
   1::356  4.7e-84 32.1% 0047854 00478541 1/1   roquinate synthase-like                 
   1::352  8.9e-84 32.4% 0036562 00365621 1/1   roquinate synthase-like                 
   1::335  3.9e-77 32.3% 0041672 00416721 1/1   roquinate synthase-like                 
   1::354  2.5e-73 31.2% 0043359 00433591 1/1   roquinate synthase-like                 
   3::356  9.2e-70 30.7% 0048580 00485801 1/1   roquinate synthase-like                 
   1::352  2.2e-45 25.0% 0044392 00443921 1/1   roquinate synthase-like                 
   1::354  2.2e-32 27.7% 0050240 00502401 1/1   roquinate synthase-like                 
   1::362


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
00476531   1/1  mllfvfllptrivfgagaldelgellkelgkrvlivtdegvaklggdrvlallkeagievvfddvepnps
00478541   1/1  mllflfllptrivfgegaldelgellkelgkrvlivtdegvaklglldrvlasLeeagiev..vvfdgve
00365621   1/1  mtllvllillpykvvigegaldelgelladlgakrvlvvtdenvaklyldrllelledagievllelrll
00416721   1/1  lflfllptkiifgagaleelgellkrlgkrvlivtdggllkklglldrvldaleeagievvvfdgvepnp
00433591   1/1  lnfvfllptkiifgagalaelgeelkrlgakralivtdgslkklglldrvldalkeagievvvfdgvepn
00485801   1/1  --lenmlnftfllptrivfgkgaldelgellkk.gkkvlivtdggvakllglldrvlaale..giev..v
00443921   1/1  mellvvlillpyeivigeglleelgell....srvlvvtdenvaklyldavlall.....gvlvivfpgg
00502401   1/1  llrlnnflfllptrivfGkgalkelgellkklgikkvlivtdgglakklglldkvldalkeagievvvfd


                         -         -         *         -         -         -         -:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
00476531   1/1  letveelvealleagadvviAlGGGsviDlAKavallrglpliavPTtagtgsevtgkavitdpegvkkn
00478541   1/1  pnptletveeale.eradviiAlGGGsviDlAKavaylrglpliaiPTtagtgsevtgkavitdpegknk
00365621   1/1  vlvvpdgeasksletverlvdalleaglevdRddvvialGGGvvlDlagfvAatylrgvpfiqvPTTllA
00416721   1/1  tletvekavelarefgadviialGGGsviDtAKaialllgnpgdlldllgvklllkpalpliavPTtagt
00433591   1/1  PtletvekavelarefgadviiAlGGGsviDtAKaiallltnpgladildllgvklllkpalpliavPTt
00485801   1/1  vfdgvepnptletveelvellrefgadviiAlGGGsviDlAKavaalllnprgidfidipttllaqvdka
00443921   1/1  epnksletlekivealleagldRssvlialGGGsviDlagfvAatylrgvpfiavPTTllaavdssvggk
00502401   1/1  gvepnPtletveeavelarefgadliiAlGGGSviDaAKaiallllnggdlldylgvklvlkkalpliai


                         +         -         -         -         -         *         -:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
00476531   1/1  lvgafllPdlvivDpellltlPprltaaggaDalahaleayvsllanlenllgellslltdalallaiel
00478541   1/1  iglfspalPdlvivDpellltlParltaaggaDalkhaleayvsllallekllglllnpltdalallalr
00365621   1/1  svDasvggktginlpggknligafyq..PkavliDpdllatlParllaaGiaeaikhaleadallfslle
00416721   1/1  Gsevtplavitdeegk.klgi.pallPdlailDpeltltlPprltaatglDalahaiEayvsllan....
00433591   1/1  agtgsevtalavitdeeggvklgiasplllPdlailDpeltltlPprltaatglDalahaiEayvsl...
00485801   1/1  lpliavPTtagtGsevtktavitnlegglKnligafallPdlvilDpellltlPprltaaggaDalkhai
00443921   1/1  aginlpggknligafy..qPkavllDpellltlParelaaGlaealkhaleadaelflllegnp..lsdl
00502401   1/1  PTtaGTGSEvtrfavitdeetgvKlgiasplllPdlailDPeltltlPprltaatgmDaltHaiEayvsv


                         -         -         -         +         -         -         -:280
query           ADGLQAMAACEAKVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTL
00476531   1/1  ileslpialadveadeldlearallllasllaglafsnaglgagHalahalgallgykfdllHGeavAig
00478541   1/1  llleklpvaladpedeavtlearalmllasllaglgfsraglglgHalghalgallgl.fdllHGeavAi
00365621   1/1  ey........adalallllelllelllralldpealeelilrsieaklavvaadelegglrallnlghtf
00416721   1/1  ......pltdalalealrllleylpravad.....dlearenlllAat.lAglafgnaglgavHalahal
00433591   1/1  .......lanpltdalalealrllleylpkavad.....dlearenlllAat.laglafanaglgavHal
00485801   1/1  Eayvsliad.....apltdllalealrllaenlpr.......avadgvdlkarevlldase.lagrafln
00443921   1/1  aaeelirrlieakakvvaaderelglr................ailnl...ghtlgHalelllg......
00502401   1/1  lan...plsdalalealrlilenlpkavkdpddl..........earenmllast.lAgiafaglglnag


                         -         *         -         -         -         -         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQ
00476531   1/1  lpavlrlnllaaelierlrellkklglpttlkdlgvdeedllellalakk.aldgrltlvnpreltkedi
00478541   1/1  glpavlrlnllaaelierllellkklglpttlkdlgvdeedllellelakkarlgdltlvlnprpltled
00365621   1/1  aHaleaglt......ygllHGeavaigmllalrlserlgllsleeierlldllkalglpttlkdlglkel
00416721   1/1  gal....fdlpHGeavAillpavlrfnaeaaperlaelaralgvdlkglsleeaa---------------
00433591   1/1  ahalgal....fdlpHGlavAillpavlrfnapaaperlaelaralglllkglsleeaaealiealrell
00485801   1/1  aglgasgaaHalehalgal....ygllHGeavaiglpavlaynlglapeklaelarallgllglpveeaa
00443921   1/1  ygllHGeavaiglvlalrlaerlglldeierllellkrlglptsl......gldledlleallldkkvrg
00502401   1/1  lgavHalahplgal....ygipHGlanaillpavlrfnaeaaperlarlaralgllglsdeeaaealiea


                         -         -         -         -         *         -         -:420
query           AIIAVDAYVNSK----------------------------------------------------------
00476531   1/1  leille----------------------------------------------------------------
00478541   1/1  ileill----------------------------------------------------------------
00365621   1/1  dl--------------------------------------------------------------------
00416721   1/1  ----------------------------------------------------------------------
00433591   1/1  kslg------------------------------------------------------------------
00485801   1/1  daliea----------------------------------------------------------------
00443921   1/1  gl--------------------------------------------------------------------
00502401   1/1  leel------------------------------------------------------------------