[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55766.1


[Show Plain Result]

## Summary of Sequence Search
   1::532
 382::529  8.5e-11 24.2% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 376::529  1.5e-10 23.2% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 374::529  2.5e-09 22.5% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 376::533  6.2e-08 20.3% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 376::529  1.1e-07 20.4% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 370::529  1.8e-07 18.2% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 401::530  4.6e-07 27.7% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 384::530  9.3e-07 20.7% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 374::533    3e-06 18.5% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 411::530  3.8e-06 27.5% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
 364::529  4.5e-06 22.2% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
 417::530  2.8e-05 26.4% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
 405::530  7.9e-05 22.0% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 370::530  8.3e-05 24.5% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 394::500  0.00078 15.9% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
   1::532


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRESTQIAQALVENQARIEGIYKYFSLS
00403441   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MPDYFYWQLERKASPYISVSLYENVDDLYVRNDFVTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAG
00403441   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NSFAIPVSDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDKESENWLVG
00403441   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LTSHGYQVQVAVPKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEXG
00403441   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVM
00403441   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
00403441   1/1  -------------------------------laelleellelllllagkgielvldldedlplvladall
00353391   1/1  -------------------------pvdlaelleellellrllaeekgieleleldgdelllvlgdplll
00520971   1/1  -----------------------elelepvdlaelleevlellrllaeekgieleleldpdllllvlgdp
00513931   1/1  -------------------------eelepvdlaelleevlellrllaeekgieleldldlp.vlgdpll
00389741   1/1  -------------------------lepvdlaelleevlellrllaeekgielvleldpdlp.vlgdpll
00381461   1/1  -------------------gklelelepvdlaelleellellrllaeekglelielvldldllllvlgdp
00353641   1/1  --------------------------------------------------fqaeikvlldleavllaage
00431421   1/1  ---------------------------------aepvdlaelleevlellrllaekgielvldlapdlpl
00460331   1/1  -----------------------grlelelepvdlaelleevlellrllekgielvldldlllvlgdpll
00384651   1/1  ------------------------------------------------------------gedierlasv
00396241   1/1  -------------ndlldlsrleagllelelepvdlaelleevlellrllaekgielvldldp.lllvlg
00482231   1/1  ------------------------------------------------------------------lkil
00439391   1/1  ------------------------------------------------------lniqlevdglldilig
00424911   1/1  -------------------ylvedllvlsrleavrlrpdmyigllelaeekgivleleldellllvlgdv
00357841   1/1  -------------------------------------------lelkaiaeklgielevdrlldilagsl


                         -         -         +         -         -         -         -:490
query           LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQ
00403441   1/1  leqvllnllsNAikhaleg.peggtitislrlegglvvltvrDnGigipe......lerifepffttkes
00353391   1/1  rqvllnllsNAikytielleerlalgkpeggtitvslrregdrvvievsDnGiGipeelllekalekgll
00520971   1/1  lllrqvllnLlsNAikytpeggllltitvslrlegdlvvisveDnGiGipeellerifepffrt..dssr
00513931   1/1  lrqvllnLlsNAikytp.ggtitislrlegdlvvlsveDnGpgipeell....erifepffrtdssrs.g
00389741   1/1  lrqvllnllsNAikytpeg..itvslrllgdllvlsveDnGpgipeell....erifepfyrtdssr..g
00381461   1/1  lrlrqvllnLlsNAikatpegleegklelgtitvslrlegdlvvisvsDnGiGippedlerifepffttk
00353641   1/1  dierlaqvlreLvdNAidag......agrievsle.dgglvlitVrDnGiGipeddlpr........lfe
00431421   1/1  vlgdplllrqvllnLlsNAikytepeggtitvslrlllllllllllegdlvvlsvsDnGpGipeelleri
00460331   1/1  lrqvllnLlsNAikyt..ggtitvslrlegdlvvlsvsDnGiGipeell....erifepffrtdssrdlg
00384651   1/1  lkeLvdNAidag......atrievtle.dgglllieVsDnGiGipeedlek........lferfatskis
00396241   1/1  dplrlrqvllnLlsNAikatpeggleslllptitvslrldgdlvvisvsDnGiGipeell....erifep
00482231   1/1  elvrkpplpiivggdprrleqvlrnLvsNAidatakggvivivvilvivisedgglvritVsDnGiGIpp
00439391   1/1  sdysrleqvlreLisNAiDAlaklvlllltdgkklaeggeitirikldkdnvlltvtDnGiGiteedlkk
00424911   1/1  egllqillelldNAidhalagpgairikvtldgdgvsieVeDnGrGIpveil....ekifepffeliltv
00357841   1/1  ysnleivlrELisNAiDAlaklrlilltdeklageggeitirllpdkeeltltvsDnGiGitkedlinif


                         *         -         -         -         -         +         -:560
query           RQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE----------------------------
00403441   1/1  r..ggtGlGLaivke.......hggeitvesepgggttf-------------------------------
00353391   1/1  seeellslselellerifepffrtkssrsrlggtGlGLa-------------------------------
00520971   1/1  srelggtGlGLaivkeivelhggt...itvesepgkGtt-------------------------------
00513931   1/1  gtGlGLaivkrivelhggt...isvesepgggttftltlplas---------------------------
00389741   1/1  gtGlGLaivkeivelhggt...itvesepgggttftltl-------------------------------
00381461   1/1  eaglsdlellnllllpglslaslvrdlgGtGlGLaivrr-------------------------------
00353641   1/1  rfatskissfddlsyivsiGgrGlGlasvralaelvivtr------------------------------
00431421   1/1  fepffrtds........ggtGLGLaivkrivelhggt...------------------------------
00460331   1/1  gtGlGLaivkrivelhggt...itvesepgggttftltlplal---------------------------
00384651   1/1  gfddlssrvtlGfrGlGlasvkalsellgg...titrdgk------------------------------
00396241   1/1  fyrtkssrsldsslrklgGtGLGLaivkrivelhggt..-------------------------------
00482231   1/1  eelpkiferfatskiksf.srliggtGlGlsivkllselh------------------------------
00439391   1/1  ifepfatsktkgflealkaggkedlsdirliggfGlGlas------------------------------
00424911   1/1  lhaggkfdddsykvsgggtGlGlsivnalsellggt...v------------------------------
00357841   1/1  gtfatsgkkg------------------------------------------------------------