[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55806.1


[Show Plain Result]

## Summary of Sequence Search
   1::234
   6::215  4.5e-48 30.9% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   4::215  1.7e-47 34.1% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   3::215  1.8e-47 35.1% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   2::211  7.2e-46 33.3% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   4::211  8.4e-46 34.5% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::211    5e-45 33.2% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   1::215  5.3e-45 33.8% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   4::215    6e-44 32.6% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   4::215  8.2e-44 30.8% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::215  8.6e-44 33.3% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   1::213  2.3e-43 35.4% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   4::215  2.9e-43 34.8% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   2::215  4.1e-43 28.6% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   1::215  1.7e-42 30.6% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   3::215    2e-42 31.1% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   3::215  3.6e-42 32.5% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   2::215  3.7e-42 31.7% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   3::215  5.2e-42 31.7% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   9::215  3.1e-41 31.8% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   5::215  4.6e-41 36.8% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   4::215  5.3e-41 31.1% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   1::213  5.4e-41 35.6% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   3::215  1.1e-40 35.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   2::215  1.5e-40 33.5% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   4::215  2.1e-40 30.8% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   3::214  5.8e-38 33.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   3::207  1.6e-37 36.0% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  10::215  1.3e-36 31.7% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   3::215    8e-36 34.1% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   3::211  8.4e-36 35.4% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   4::214  2.1e-34 36.6% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   3::231  3.4e-34 32.7% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   4::212  3.8e-34 37.1% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   1::211  8.8e-34 37.2% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::215  7.2e-33 34.3% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   6::215  1.3e-32 39.0% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   3::234  5.1e-32 31.7% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   3::232  2.2e-30 30.9% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::229  1.8e-29 28.8% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   3::213  3.5e-29 29.7% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   4::216  1.2e-28 33.0% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   3::207  4.6e-28 34.7% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  24::211  6.2e-28 41.7% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  19::209  1.3e-27 36.5% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  29::182  9.9e-27 35.2% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  18::213  3.9e-26 31.6% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  21::211  6.5e-26 36.4% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  30::207  7.7e-26 33.1% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   8::203  9.1e-26 29.5% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   3::216  6.1e-24 31.4% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   4::207  1.4e-23 26.8% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  27::215  4.4e-23 35.0% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  27::221  1.7e-22 30.3% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   7::207  3.1e-20 27.0% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   4::207  2.9e-19 32.4% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   6::212    4e-19 28.8% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  23::169  6.9e-19 31.2% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  16::211  7.5e-19 33.1% 0053253 00532531 1/1   arboxykinase-like                       
  27::213  9.2e-19 30.5% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  15::201    3e-18 29.1% 0047841 00478411 1/1   arboxykinase-like                       
  12::215  3.3e-18 31.2% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  21::217  3.5e-18 29.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   9::211    6e-18 30.3% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  26::228  1.2e-17 27.7% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   9::211  1.3e-17 35.3% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
   9::211    3e-17 33.1% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   1::214  1.7e-16 32.0% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   1::127  2.5e-16 33.6% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  27::214  3.3e-16 27.5% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  15::186  8.8e-16 30.6% 0047552 00475521 1/1   arboxykinase-like                       
   6::222  1.2e-15 25.2% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  26::203  2.1e-15 31.2% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  28::190  7.3e-15 31.1% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  29::215  7.3e-15 29.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   5::203  8.3e-15 22.5% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  28::230    2e-14 29.6% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  29::226  2.9e-14 27.4% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  28::207  1.6e-13 33.1% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  29::224  2.4e-13 22.3% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   6::195  4.2e-13 20.7% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  26::214  7.2e-13 25.2% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  28::187  1.1e-12 26.2% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   7::199  1.9e-12 25.5% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   1::201  3.7e-12 31.3% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  28::203  5.8e-12 24.2% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  26::215  6.6e-12 28.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  29::196  8.2e-12 29.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  28::203  1.6e-11 28.6% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  29::215    2e-11 27.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   7::220  2.6e-11 20.6% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
   3::200  4.9e-11 29.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  28::214  1.8e-10 28.9% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  30::215  3.3e-10 20.0% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  20::227  6.9e-10 22.0% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   7::201  7.7e-10 28.1% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   7::203  9.7e-10 27.6% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
   1::199  1.1e-09 24.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  30::214  1.9e-09 18.6% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   2::200  5.5e-09 27.6% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  29::214  7.1e-09 21.1% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   8::208    8e-09 20.8% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  16::201    1e-08 32.8% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  22::218  1.7e-08 20.6% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   7::199    2e-08 26.1% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  23::194  4.1e-08 33.3% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  15::207  5.9e-08 28.5% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  16::210  7.8e-08 24.1% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  26::234  4.9e-07 24.0% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
   2::207  8.5e-07 19.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   4::201  2.3e-06 23.8% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   7::210  4.7e-06 23.0% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  15::200  8.4e-06 23.6% 0047844 00478441 1/1   arboxykinase-like                       
  28::217  1.8e-05 19.5% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  25::180  3.4e-05 27.5% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  26::170  9.1e-05 25.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::234


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKVAISKTNTQGK
00390411   1/1  -----MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirr
00422801   1/1  ---llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllk
00379581   1/1  --lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00436071   1/1  -pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldllal
00367901   1/1  ---lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidli
00509431   1/1  M..lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsd
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00490801   1/1  ---llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeival
00510251   1/1  ---lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeiv
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00425571   1/1  ---lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllal
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00466971   1/1  --llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00500441   1/1  --lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgk
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00475891   1/1  --lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00466931   1/1  --------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdi
00404101   1/1  ----elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltal
00530591   1/1  ---llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00361211   1/1  --plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvl
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00475991   1/1  ---lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpt
00488521   1/1  --lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGe
00436511   1/1  --ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikk
00485451   1/1  ---------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00469451   1/1  --allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgk
00367481   1/1  --yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllp
00422141   1/1  ---dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielif
00495371   1/1  --esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evl
00379601   1/1  ---llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvld
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00496111   1/1  -----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglel
00500611   1/1  --pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsge
00495031   1/1  --lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplg
00503371   1/1  Mmlkslelknf.....kslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdll
00424961   1/1  --lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglld
00437981   1/1  ---lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilld
00464791   1/1  --lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkG
00485931   1/1  -----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
00448931   1/1  ------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl
00381441   1/1  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00475371   1/1  -----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi...
00468601   1/1  --------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra
00512891   1/1  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsa
00368501   1/1  -------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGK
00371631   1/1  --mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrll
00379961   1/1  ---yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsg..........
00414121   1/1  --------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeili
00457311   1/1  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00379261   1/1  ------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTt
00437941   1/1  ---lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvr
00503741   1/1  -----fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLa
00480471   1/1  ----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgei
00532531   1/1  ---------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinle
00477971   1/1  --------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrppr
00478411   1/1  --------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralaglGtilldg.dlvrlglkd
00462761   1/1  -----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr
00490731   1/1  --------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp...
00434401   1/1  --------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr
00464411   1/1  -------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsge
00392701   1/1  --------lealagarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd......
00406781   1/1  --------lealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase......
00404191   1/1  lpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa.
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00426051   1/1  --------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdl
00475521   1/1  --------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdgdlvdle
00489571   1/1  -----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00487021   1/1  -------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtddllr
00515531   1/1  ---------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtiei.
00405881   1/1  ----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgv
00368571   1/1  ----dgdglgvllGkll..dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkg
00475381   1/1  ---------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlav
00496571   1/1  ----------------------------GkgelivllGpsGsGKsTlarlLagll....ggsvldtgepi
00510561   1/1  ---------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGik
00533501   1/1  ----------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig
00356411   1/1  -----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgv
00468951   1/1  -------------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgi
00515511   1/1  ---------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieid
00394721   1/1  ------vllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilld.....
00420941   1/1  lrpvllddv...igqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagelga
00532471   1/1  ---------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvg
00439861   1/1  -------------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalq
00484101   1/1  ----------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigr
00493431   1/1  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrepr
00499191   1/1  ----------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd........
00477011   1/1  ------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptel
00386741   1/1  --klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrlda.
00498531   1/1  ---------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGik
00513761   1/1  -----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpara
00480251   1/1  -------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr.
00367291   1/1  ------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanelga
00444381   1/1  ------vlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgenvlLvGpp
00437901   1/1  slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlak
00480441   1/1  -----------------------------rlivllGpsGaGKsTlaklLaell.pglivisvgdttrepr
00473941   1/1  -eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga........
00498811   1/1  ----------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddlt
00527261   1/1  -------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakelgkpviyid
00521551   1/1  ---------------eeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagllgap
00517691   1/1  ---------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg......
00437921   1/1  ------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsg
00432181   1/1  ----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlg
00402371   1/1  --------------leallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpf...
00513251   1/1  ---------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..
00482551   1/1  -------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaa
00470731   1/1  -arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralakel..gagfilidgdd
00430121   1/1  ---iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKT
00416171   1/1  ------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr...............
00478441   1/1  --------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl...Gailvdddlvllel
00489631   1/1  ---------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllr
00451571   1/1  ------------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl..
00508671   1/1  -------------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLee


                         -         -         *         -         -         -         -:140
query           KLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKASLDSVGMWEHRDKRLGSLSG
00390411   1/1  gadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrg
00422801   1/1  llagllkptsGeilldgldilalslaelrrrigyvfqdp....alfpltvrenlalglllallllglska
00379581   1/1  talslaelrrrgigyvfqdp....alfpgltvrenlalglllllllllllllllllalskaearervlel
00436071   1/1  rrgigyvfqdp....alfpgltvlenlalgllllgll......ealaralellellglgdl.drlvseLS
00367901   1/1  lkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdp...a
00509431   1/1  liflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr.lig
00378981   1/1  slaelllllrrgigyvfqdp....alfpgltvrenlalgllla....glskaeaaaraaellellglddl
00490801   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00510251   1/1  alvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00420701   1/1  llslaellalrrgigyvfqdp....alfpgltvrenlalglllag....lskaeararalellellgldd
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00425571   1/1  sllrrrigyvfqdp....alfpgltvrenlalgllll....glskaeaaaralellellglddlldrlvg
00458601   1/1  spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgl
00482201   1/1  slkelrgigyvvqqdall...psltvlenlllgllllgllllllaakeaalralllllllgletlldrlp
00466971   1/1  ilglslaelllllrrgigyvfqdpa...lfpgltvlenlllgllllglllllaakeaalrlellllllgl
00500441   1/1  dildlsllrrgigyvfqdpa...lfpgltvlenlllgll....llglslaeaaeralelllllgledlld
00482261   1/1  slaelrgigyvfqqdall...psltvlenlllgllllgellllllaakeaalralllllllgletlldrl
00475891   1/1  dilglsllellrrgigyvfqdpalf...pgltvlenlllgll....llglalkeaalralllllllglet
00466931   1/1  lalspeellrllrrrigyvfqepa...lfpgltveenlllglllrlllelllgrlelllllllllellal
00404101   1/1  slaelrrgigyvfqdp....alfpgltvrenlalgll.........kaeararalellellgldelldrl
00530591   1/1  lkptsGeilldgkditdlslkelrgigyvvqqdall...psltvlenlllgllllgllllllaakeaalr
00372301   1/1  vdgedlr.....igyvfq.........................................llervgledll
00361211   1/1  ldgleisalslaerlragigyvfqdl....alfpeltvlenlalg.................rareller
00502741   1/1  slaelrgigyvfqqla...llpsltvlenlalgll....llglskaeaaaraaellellgledlldrlps
00475991   1/1  sGeilldgkdildlslaelrgigyvfqq...dallpsltvlenlllglllagellllllaakeaalrall
00488521   1/1  i..........ggkvlyvdqee....slfpltvlenlalg...............gedveellerlgl.d
00436511   1/1  GervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpal
00485451   1/1  vlvigldifrlsarelrkrigvfqdpa....llphltvpenldlglll..........eilervlellel
00469451   1/1  dvlylsleesleqlrrrigyvfqdpalfp................................aeellelvg
00367481   1/1  asggi...............lvpgedalll...............................rvdeiltrv
00422141   1/1  ldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltled
00495371   1/1  vdgldltglsparggiglvfqteallpp...ltvrenlealgldlr.glld......rerviellelvgl
00379601   1/1  llsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltl
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvd.....Gedlrelrelrrrigyvfqdp...alfpeltvl
00498251   1/1  Lalrllagllkpgggvvyidgeesldll.rarrlgvvlqelllfpeltveenl.................
00496111   1/1  saeelrerrrrigyvfqepa....lfpeltvlenlalgll..............................
00500611   1/1  illggkvlyisleeslrrrrigmvfqel.......................gldpdltv.arervielle
00495031   1/1  gkvlyigleltlsperlrlraqsl.......................gl.dldellerllvidllelvgl
00503371   1/1  iylsdlirrgagiayveqefdlfd...gltvlenvllglgdeliirrrilrdgrseyllnglgvslkeli
00424961   1/1  pdsgeilldgvdigersrevtelleelrrviglvfqdp...plfprltvaenialgaeyf....rdegad
00437981   1/1  gkdi...rrgiglvfqli...glfphltvlelvalgl..........ggilveevrellkel........
00464791   1/1  ervglvGpnGaGKTtLlkllagllkpdsgeivvy.....g...ligerprevrellglllelgvlf....
00485931   1/1  .rrigavpqlp....vlfprltvlenlalg...........gadlaeraeellellglegfdvvliDtag
00448931   1/1  a.....areqlgivfqdpgltvlenlalg.............eleararellellgledydvvliDtagr
00381441   1/1  gevdgvdltfls......reeigyvfqepa...llpdltvlenlylglllalllaleegkivildgdrer
00475371   1/1  .......................................rrpsarellgllgellgldvlvgarggdlsg
00468601   1/1  aaaerlgigavpqdv...plfpsltvldnlalar.......dlleaakaagydvvlidtaglld.ldrlv
00512891   1/1  rrgigyvfq...........tveellgllaelvglevrg................eleellktlikelsg
00368501   1/1  TtlaralakllgapfiridgseltekdyvGesvearlrelfeeaigyvfqdp....alfpgtvlenlalg
00371631   1/1  gklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrigllf
00379961   1/1  ..........rivlvgnlsdlldpkdlrellragiplvflnfaalpasllesel...............l
00414121   1/1  dgqlledlgvlavrlgigyvpqtl...glfpaltvlellalall.................lredpdlil
00457311   1/1  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk................llepvgl
00379261   1/1  laralAkllgapfvevdaselteggyvgedlekr..irelfqearl...lvfltvlenirldaseylekr
00437941   1/1  vlgidaselld...........................................................
00503741   1/1  kllagllkpkfgeillfg.........................kvvyvnvsell.dlkellrll......
00480471   1/1  lldgkdltlvdtpgiargrlklllearraaigivfqdv....dllltltvaenlllgldllllellkelk
00532531   1/1  ggfyakaigllrrkigyvfq......lfpfltvlenvalgld......glvdeedleraenllalvglee
00477971   1/1  pgevdgvgyvfqsrelfpeltvagnfleg.......aevrgnlygtsrerveellea.gldvlldidpqg
00478411   1/1  ...gigmvfqdpalfpl...ltvrengvalglllag....lskaeieervdlllelvglddlldrypdel
00462761   1/1  .lglliglvfqdp....dllpfltvlenvllpllaagliv.........ivdgtlllvglrealrkllgl
00490731   1/1  ...............................yrpaadellgvlaee........lgldvllgarggdlsg
00434401   1/1  paaell.lreglgidfqlpdal.....................drellreevlellglgevvivdvydls
00464411   1/1  plge.ligevfqdgilfpdltvlenvalgrygllglikealaegviv...ildrvglsdla..ypgflsg
00392701   1/1  ...........................................................llgkyvgelsg
00406781   1/1  ...........................................................llgkyvgelsg
00404191   1/1  .................................................................delvs
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdp..-------------
00426051   1/1  ggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellle
00475521   1/1  plrrdigmvfqdpa...lfplltvrenvilgllelaglsk...aealarvdellelvglddellldrlp.
00489571   1/1  ......................................................................
00487021   1/1  a....gevfqdyalfphltvlelldnvllgleir.gllk...aerlervevllervgl..lldrippals
00515531   1/1  ....dgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdln...lfpslt
00405881   1/1  veldd......................grqlvlvDtpGlielaslgeglvrqalealeradvillvvdas
00368571   1/1  eyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilal
00475381   1/1  lsrdllgllreglirigyvfqdyalfprl...tvlenvllgll...........................
00496571   1/1  rgeplgelir.glvfq...dpllldeltvlenlalgrylhl...glilaalaagvgvvldrvglsdlayg
00510561   1/1  aLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleqlrarrlgld.....
00533501   1/1  tplgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydgfpr
00356411   1/1  kltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi
00468951   1/1  kaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlrarrlgldlddl
00515511   1/1  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00394721   1/1  ..................................................gvpvvrldlsellsvsdlvg
00420941   1/1  pfiridg...............................................................
00532471   1/1  elggaalldivdegrliglvfqdldllpllevlellaa...........................rleel
00439861   1/1  laanlaknggkvlyisle.....esreqllera.....................................
00484101   1/1  ldldellgigylfqdvgll...pvltvrenlalllrglpgysaeeleralellelagfdvilieGllela
00493431   1/1  pgevrgigyvfqsgalfphl...ivagnllegaevhgllygtskerveealekgllvlldr.........
00499191   1/1  .gllvgvvfqddfyl....llpalevlengafll..dlllpdaldrelllelllalveglvvlldryprl
00477011   1/1  rlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdlt
00386741   1/1  ......................................................................
00498531   1/1  aLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleqlrarrlgldldell
00513761   1/1  nlpeqlgi......dirdlidletvme.lglgpngalvfaleellttldillealelleedydyiliDtp
00480251   1/1  ..................psapeqlgilgellgvpvvgvltgldlagalrealellllegydvvliDtag
00367291   1/1  pfirvdase.............................................................
00444381   1/1  GtGKTtlakalakllgvpfiridgselte.......kelvGe............................
00437901   1/1  alakelgapvieidaselrd..................................................
00480441   1/1  egevlgvdyvfvdrelfeelivagnlled...........aivhgllygtskerieealda.glgvlldg
00473941   1/1  .........................................................pfielsasdllg.
00498811   1/1  relvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvvile
00527261   1/1  lselsskgyvdleellrelaeelgell..........................ellkkllkklsellgls
00521551   1/1  fvrlsas...............................................................
00517691   1/1  ...........................................gtlllllgllsfllalvldslplerer
00437921   1/1  ggvdvielda............................................................
00432181   1/1  vveldgrkl....................................................vliDtpGle
00402371   1/1  ....................................................vrldasellefgkyvgaf
00513251   1/1  ......................................................................
00482551   1/1  naalplelgklggkvlyistee...afsperlreralsl...............gldleelldrllvida
00470731   1/1  lrekavgeleklgrdlfqvaregglvpdilfideidall...........rkgpdvildgagrtpeqlea
00430121   1/1  tlakalagllfp...............................................sgvpfirinls
00416171   1/1  ................................sgvpfvrvncsalte......dlleselfghekgafgg
00478441   1/1  rgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld.................
00489631   1/1  ellgellgrgigfgfqqgdlledatvlenlalllldeidka....................ledggvvll
00451571   1/1  .......lreaiglvtqdgelllelidegilvpdeiviellrealeeldad.gvildgfprllgqaell.
00508671   1/1  pgsgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglelrdelrellke


                         +         -         -         -         -         *         -:210
query           GQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELMHHSAHHHGKAVLMITHDPEEVKDYADRNIH
00390411   1/1  iglvpqeh...dlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllell
00422801   1/1  eararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellell
00379581   1/1  lelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelake.gltv
00436071   1/1  gGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv
00367901   1/1  lfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraee
00509431   1/1  yvpqdpn...llfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeelel
00378981   1/1  ldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlse
00490801   1/1  .......lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLD
00510251   1/1  ....lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpet
00420701   1/1  lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdls
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdp...
00425571   1/1  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealalad
00458601   1/1  edlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvtHd
00482201   1/1  seLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gltvllvthdlsea.rla
00466971   1/1  etlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelake.gltvllvthd
00500441   1/1  rlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlseal
00482261   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gltvllvthdlseal.l
00475891   1/1  lldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gltvllvthdld
00466931   1/1  lldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldr
00404101   1/1  vgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gltvllvthd
00530591   1/1  alllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..
00372301   1/1  drlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlela
00361211   1/1  lglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakel
00502741   1/1  eLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdldealrlad
00475991   1/1  lllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.glt
00488521   1/1  lldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlak
00436511   1/1  pallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftllsr---
00485451   1/1  vgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrti
00469451   1/1  ledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtv
00367481   1/1  glsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvv
00422141   1/1  lglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.......ieyvf
00495371   1/1  eelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvth
00379601   1/1  edllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel.l
00468691   1/1  enlalgallag....................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDE
00498251   1/1  ..................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrl
00496111   1/1  drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtvil
00500611   1/1  lvgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvt
00495031   1/1  lelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvth
00503371   1/1  ellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekr
00424961   1/1  vllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdl
00437981   1/1  ....lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilathdlsellp
00464791   1/1  ..................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllD---
00485931   1/1  rgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel....gltvlvvthdd
00448931   1/1  lrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel....gltvlvvthlD-
00381441   1/1  aeellellgldadlviilpasleellerldrrggelsggqkq----------------------------
00475371   1/1  glrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadr
00468601   1/1  gelsggqkqrvaiarala.apevllldeptsgldalae..llelleel....gltvlvvtKlDgtakggh
00512891   1/1  gekqrvalarallakpdvlllDEid.gldpdvleallelleel.krsgvtvilttndldel.eladr---
00368501   1/1  llvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviall-------
00371631   1/1  q....kglpealdveellellldlke........................gledilvpvlsggqkqrlal
00379961   1/1  sggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllp---
00414121   1/1  id.........sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvliv
00457311   1/1  pevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirl
00379261   1/1  vvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevg---
00437941   1/1  ...pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleel..pkgvtvilttnrl---
00503741   1/1  .....lealglpppyq.....lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrl
00480471   1/1  ydpvilllnkidllddrllrraeaeerie-----------------------------------------
00532531   1/1  ipnrypselsgGqqqrv...........illldEPtsgLdpvsr..........................
00477971   1/1  lsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdvvivnhdleealelld
00478411   1/1  sggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalelllld---------
00462761   1/1  lsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.iee
00490731   1/1  glrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilv
00434401   1/1  ggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifvdhdlevalerrlkrl
00464411   1/1  geqqrvaiarallpkpdlvllldepteeldeRllkRgrllek.....leyikkrlehylelaepyk.ddv
00392701   1/1  glrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnr
00406781   1/1  glrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattnd
00404191   1/1  klsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaer.gvtlilttnnrpeeldq
00387201   1/1  ----------------------------------------------------------------------
00426051   1/1  .gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellell
00475521   1/1  ..sggqqqeilrvaiallilpvllgralallpelllldeptsaldp------------------------
00489571   1/1  ..lallelrntteagaasgsrdkgllgklkpetraelldllre....egttilvvth.ldeaer.aDrva
00487021   1/1  gGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpe.gilpdlvifld-------
00515531   1/1  vlenl..anvpillvlnKiDlleakeraeellellglgdlldklpselsg--------------------
00405881   1/1  dplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee........lggtvvlv
00368571   1/1  aeepeptldellellselg..lrdladrleklvagglagllegaektaasilellrkllalll-------
00475381   1/1  .llgglvvildggvrqrlalarallldpdvllldeplllldaalr............dlpdlvifldadp
00496571   1/1  fprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.........rlgdteevlehrlera
00510561   1/1  .....................ldrlllldaltv.........eellalaerllsggkvdlvviDslt---
00533501   1/1  llsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eevlekrlehylellekad
00356411   1/1  ilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaralakdpdi---------------
00468951   1/1  lllpaltveellala......................................erllsggkpqlvviDsl
00515511   1/1  pillvlnKiDlleaklvllllvglfdlldglpselsggqkqrvalar-----------------------
00394721   1/1  elegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlvi-----------
00420941   1/1  ..sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevl---------
00532471   1/1  lerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlpl-------
00439861   1/1  ....erlgldleellllgllsiliadplglsgeellrvllalalelkpdlliiDeltalldaervrelre
00484101   1/1  lplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlllell--------------
00493431   1/1  ...dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgpliey-------
00499191   1/1  lsggqrqrvaia.....dpdvlildgptllldpelrpladlvifldaspeelleRllkRgrlergddlee
00477011   1/1  lvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedand..ldtesdalellkelleegkrti
00386741   1/1  ..selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggll----------
00498531   1/1  llpaltveellala......................................erllsggkpdlvviDslt
00513761   1/1  GglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllsee
00480251   1/1  glqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsva
00367291   1/1  ....lleklvg..egegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaL---------
00444381   1/1  ..........................segailsggfkqrvgia..lladpgilflDEidklld-------
00437901   1/1  ..........vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpd-----------
00480441   1/1  fprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnd
00473941   1/1  .esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglv----------
00498811   1/1  gplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.lsle
00527261   1/1  ilglelilglsggdleelleelaellkklgkpvililDEiqslldvsskelleaLlrlldegknvtii--
00521551   1/1  ..elvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvln---------
00517691   1/1  gitidvalarllldgrkilllDtP..Ghed.....fvkevlralrladgallvvdadegvslpqtrevll
00437921   1/1  ........sdlrgvddlreligevlqalglllggkpdvlllDEi.drldpdaqnallkl-----------
00432181   1/1  efa.......sggekqrvalalallreadvlllvvdadeptsfldle....lle----------------
00402371   1/1  egglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg....nvrviaatnr---
00513251   1/1  gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv.lviflatspevlierlldrvll
00482551   1/1  t......dlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrla
00470731   1/1  lldlleelgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleilkrllkklg.t---
00430121   1/1  e......ltekllvselighppg.yvGedelgvlfeaarkappsvlllDE.idkldpdvln---------
00416171   1/1  gekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlpadvrliaatnpdlle
00478441   1/1  drypyelsggerqrvailr..vllpklllpdepgrnldvliev...avlnlilkllgida----------
00489631   1/1  dgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvivtd
00451571   1/1  .lsggkadlvifldaplevlleRllkrddekilkrleeqk------------------------------
00508671   1/1  aglpllvvfldaplevlleRdrrglypeel----------------------------------------


                         -         -         -         +         -         -         -:280
query           LVRNQDSPWRCFNVHENGQEVGHA----------------------------------------------
00390411   1/1  eglke-----------------------------------------------------------------
00422801   1/1  relak-----------------------------------------------------------------
00379581   1/1  llvth-----------------------------------------------------------------
00436071   1/1  v---------------------------------------------------------------------
00367901   1/1  l---------------------------------------------------------------------
00509431   1/1  i---------------------------------------------------------------------
00378981   1/1  alrla-----------------------------------------------------------------
00490801   1/1  petra-----------------------------------------------------------------
00510251   1/1  raell-----------------------------------------------------------------
00420701   1/1  ealrl-----------------------------------------------------------------
00440861   1/1  .nl-------------------------------------------------------------------
00425571   1/1  rilvl-----------------------------------------------------------------
00458601   1/1  ldeal-----------------------------------------------------------------
00482201   1/1  drilv-----------------------------------------------------------------
00466971   1/1  ldeal-----------------------------------------------------------------
00500441   1/1  rladr-----------------------------------------------------------------
00482261   1/1  adril-----------------------------------------------------------------
00475891   1/1  ealrl-----------------------------------------------------------------
00466931   1/1  pvstL-----------------------------------------------------------------
00404101   1/1  ldeal-----------------------------------------------------------------
00530591   1/1  gltvl-----------------------------------------------------------------
00372301   1/1  all-------------------------------------------------------------------
00361211   1/1  gvtvi-----------------------------------------------------------------
00502741   1/1  rilvl-----------------------------------------------------------------
00475991   1/1  vllvt-----------------------------------------------------------------
00488521   1/1  elgv------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00485451   1/1  ilvth-----------------------------------------------------------------
00469451   1/1  ilvtH-----------------------------------------------------------------
00367481   1/1  t---------------------------------------------------------------------
00422141   1/1  qspn------------------------------------------------------------------
00495371   1/1  dleeveeladrvavlaggriv-------------------------------------------------
00379601   1/1  rn--------------------------------------------------------------------
00468691   1/1  p---------------------------------------------------------------------
00498251   1/1  lrlak-----------------------------------------------------------------
00496111   1/1  vthdl-----------------------------------------------------------------
00500611   1/1  vllvthdlreveeladkrdrvvvl----------------------------------------------
00495031   1/1  dlrevegrleladrvvvlrggr------------------------------------------------
00503371   1/1  lellekeleeleellerle---------------------------------------------------
00424961   1/1  lll-------------------------------------------------------------------
00437981   1/1  allsrc----------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00485931   1/1  g---------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00475371   1/1  ilv-------------------------------------------------------------------
00468601   1/1  d---------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00371631   1/1  aralve----------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00414121   1/1  lnKiD-----------------------------------------------------------------
00457311   1/1  itrdlgeagrs-----------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00503741   1/1  le--------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00532531   1/1  .---------------------------------------------------------------------
00477971   1/1  ril-------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00462761   1/1  vadri-----------------------------------------------------------------
00490731   1/1  lleglgv---------------------------------------------------------------
00434401   1/1  g---------------------------------------------------------------------
00464411   1/1  vvidangsieevveeilk----------------------------------------------------
00392701   1/1  p---------------------------------------------------------------------
00406781   1/1  l---------------------------------------------------------------------
00404191   1/1  allr------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00426051   1/1  erla------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00489571   1/1  vldd..Gtpeel----------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00405881   1/1  Sahdg-----------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00475381   1/1  eelleRllkRgrergeaidl--------------------------------------------------
00496571   1/1  eeladrlialy...eg------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00533501   1/1  ..rvvvidaggsle--------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00468951   1/1  talr------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00439861   1/1  llral-----------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  vleri-----------------------------------------------------------------
00477011   1/1  vvvtKiDlld------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00498531   1/1  alap------------------------------------------------------------------
00513761   1/1  g...l-----------------------------------------------------------------
00480251   1/1  lil...glpilflgtge-----------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00480441   1/1  dlee------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00498811   1/1  evvd------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00517691   1/1  lllllgvp--------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00482551   1/1  kelgvtviltsqltrevedradkr----------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00489631   1/1  dl....e---------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------