[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55904.1


[Show Plain Result]

## Summary of Sequence Search
   1::474
   1::472 1.1e-146 41.9% 0044574 00445741 1/1   like                                    
   1::472 2.5e-145 42.2% 0036174 00361741 1/1   like                                    
   1::472 3.3e-145 42.6% 0035565 00355651 1/1   like                                    
   1::474 1.3e-143 40.1% 0037193 00371931 1/1   like                                    
   1::472 1.6e-141 41.7% 0041750 00417501 1/1   like                                    
   1::472 6.6e-140 42.2% 0035766 00357661 1/1   like                                    
   1::472 1.2e-139 42.8% 0040316 00403161 1/1   like                                    
   1::472 1.3e-138 41.9% 0035037 00350371 1/1   like                                    
   1::472 2.8e-138 41.2% 0034877 00348771 1/1   like                                    
   2::473   1e-137 42.6% 0050666 00506661 1/1   like                                    
  15::472   1e-128 41.7% 0037277 00372771 1/1   like                                    
  40::472 6.5e-120 41.5% 0035003 00350031 1/1   like                                    
  39::472 1.8e-111 42.9% 0041670 00416701 1/1   like                                    
  37::472 1.6e-107 41.1% 0044883 00448831 1/1   like                                    
   4::432 4.6e-101 40.4% 0047758 00477581 1/1   like                                    
   1::474


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEADEAMQAARAALPXWXALSAIERAAYLHKT
00445741   1/1  lellellnelllllllgslllllllllllllllllltlklliggewvagsgetldvinPatgevlatvpl
00361741   1/1  lllllllllllltlkllingewvasasgetldvinPatgevlatvplasaedvdaaveaaraafksgeaw
00355651   1/1  llllllllllllllllltlkllingewvagasgetldvinPatgevlatvplasaedvdaaveaaraafd
00371931   1/1  lltlklliggewvasgetlevinPatgevlatvplasaedvdaaveaaraafkawaalsaaeRaaillkl
00417501   1/1  lelllllllllltlklfigGewvasasgetldvinPatgevlatvplataedvdaaveaaraafksglaw
00357661   1/1  lelllllllllltlklligGewvasasgetldvinPatgevlatvplasaedvdaavaaaraafksglaw
00403161   1/1  lellllllllllllltlklfigGewvasgetidvinPatgevlatvplataedvdaaveaaraafekawa
00350371   1/1  lsllllllllltlklligGewvasasgetldvinPatgevlatvplasaedvdaavaaaraafksgeawa
00348771   1/1  lllllllllllllllllltlklfiggewvaslssgetlevinPatgevlatvplasaedvdaaveaaraa
00506661   1/1  -ltlkllinGewvagsgetlevinPatgevlaevplasaedvdaavaaaraafkawralsleeRaaillk
00372771   1/1  --------------sgetlevinPatgevlagtvplataedvdaavaaaraafkawaalslaeRaaillk
00350031   1/1  ---------------------------------------dvdaaveaaraafkawaalsleeRaaillal
00416701   1/1  --------------------------------------edvdaaveaaraafrawatlsleeRaaillkl
00448831   1/1  ------------------------------------saedvdaaveaAraafrawatlsleeRaaiLlal
00477581   1/1  ---llllllsllagsgetlevlnPatgev............daavaaaraafeawralglaeraelllkl


                         -         -         *         -         -         -         -:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
00445741   1/1  ataedvdaavaaaraafkawaalsaaeRaaillkladlleeradelaalltletgkplaealgevaraad
00361741   1/1  aalsaaeRaaillkladlleeradelaalltletgkplaeallgevaraadflryyagladrllgevips
00355651   1/1  sgkawaalsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrllg
00371931   1/1  adlleenadelaalltletgkplaealgevlraidflryyaglarkllgpvipvvglllllpgllllvvr
00417501   1/1  aalsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrllgevips
00357661   1/1  aalsaaeRaaillkladlleeradelaalltletgkplaeallgevaraadflryyaglarrllgevips
00403161   1/1  alsaaeRaaillkladlleeradelaalltletgkplaealgevllaadflryaaglarrllgltipvgv
00350371   1/1  alsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrllgevipsd
00348771   1/1  fkawaalsaaeRaaillkladlleeradelaalltletgkplaealgevaraadflryyaglarkllgev
00506661   1/1  ladlleeraeelaalltletgkplaeallgevaraadflryyaglarrllgetilsdgp.....gllalv
00372771   1/1  ladlleeradelaalltletgkplaealgevllaidflryaaglarkllgltipvglllllllllpglla
00350031   1/1  adlleenadelaalltletgkplaeallgevllaadflryyaglarkllglvipvg..llllpglllyvv
00416701   1/1  adlleenaeelaalltletgkplaealgedlllrllltlervalaadllryvagladrllglllllv...
00448831   1/1  adlleenadelaealalelgkplaealldalldrLllteggevllaadvlryaagladplggvvlvlelp
00477581   1/1  .dlleenaeelaalltleagkplaealgeavalaadflryfae.aqkllgpviellp......gvllyvr


                         +         -         -         -         -         *         -:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
00445741   1/1  flryyaglarrllgevivstl....lpgllalvvrePlGvvavitPwNfPlllalwklapALaaGntvvl
00361741   1/1  dp......glllyvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltplsalllaellle
00355651   1/1  evipsdp......gllayvvrePlGvvavitPwnfPlllalwklapALaaGntvvlKpseltpltallla
00371931   1/1  ePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltplsalllaellleaglPegvvnvvtgpga
00417501   1/1  dp......gllayvvrePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltpltalllaellle
00357661   1/1  dp......gllayvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltpltalllaellle
00403161   1/1  ill.lpgllayvvrePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltplsalllaellreag
00350371   1/1  p......gllalvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltplsalllaelllea
00348771   1/1  ipsdp......gllayvvrePlGvvavitPwnfPlalalwklapALaaGntvvlKpseltpltalllael
00506661   1/1  vrePlGvvaaitPwNfPlalalwklapaLaaGntvvlKpseltpltalllaell.eaglPegvvnvvtgd
00372771   1/1  yvvrePlGvvgvitPwNfPlalalagwklapALaaGntvvlKpseltplsalllaelirealeeaglPeg
00350031   1/1  rePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltplsalllaell.eaglPegvvnvvtgdg
00416701   1/1  .ldpglllyvvrePlGvvgvitPwnfPl.la.rkaapaLaaGNavvlkpseltplsalalaelirealee
00448831   1/1  ....nglllyvvrePlGvvavitPwnfPl.la.wkaalaLaaGNavvlkpseeaplsalalaellaeala
00477581   1/1  rePlgvvgvivPwNfPlalstvlmklapAlaaGvpntvvlkPseltpltal....llaeaglp.gvlnv.


                         -         -         -         +         -         -         -:280
query           EIGDYIIEHKEVNFINFTGSTPIGERIGRLAGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSG
00445741   1/1  KpseltpltalllaellreaGlPagvvnvvtgpgaevgeaLvahprvdlvsftGstavgkavaeaaakrl
00361741   1/1  aglPagvvnvvtgpgaevgdaLlahpdvdlvsftGstavgrliaeaaaysnlkpvtlelgGknpvivldd
00355651   1/1  ellleaGlPagvvnvvtgpgaevgeaLvahpdvdlvsftGstavgrliaeaaaksnlkpvtlelgGknpv
00371931   1/1  evgeaLlahprvdlvsftGstavgrlvaaaanlkpvilelgGknpvivlddadldlaveaivlskflnaG
00417501   1/1  aglPagvvnvvtgpgaevgdaLlahprvdlvsftGstavgrlvaeaaaksnlkpvilelgGknpvivldd
00357661   1/1  aGlPagvvnvvtgpgaevgeaLvahpdvdlvsftGstavgrliaeaaaksnlkpvtlelgGknpviVldd
00403161   1/1  lPagvvnvvtgdg.evgeaLvahpdvdlvsftGstavgrlvaaaanlkpvilelgGknpvivlddadldl
00350371   1/1  glPagvvnvvtgpgaevgeaLlahpdvdlvsftGstavgrlvaeaaaksnlkpvilelgGknpvivldda
00348771   1/1  lreaGlPagvvnvvtg.gaevgeaLvahpdvdlvsftGstavgrlvakaaasnlkpvtlelgGknpvivl
00506661   1/1  gaevgeallahpdvdlvsftGstavgravakaaaknlkpvtlelgGknpvivlddadldlaveaivagaf
00372771   1/1  vvnvvtgsgrevgeaLvahprvdlvsftGstavgrlvaeaaaknlkpvpvtlelgGknpvivlddadldl
00350031   1/1  evvgall..hprvdlvsftGstavgrlvaeaaasnlkpvilelgGknpvivdddadldlaveaivlgkfl
00416701   1/1  aglPegvvnvvtgdgraevgeaLvahplvdlvsftGstavgkavae..nlkpvvlelgaGknpvivdeda
00448831   1/1  eevgeaglPegvvnlvtg.grevgdaLlehplvdliiftGstavgravaeaa.lkpvilelgGknpvivd
00477581   1/1  .g.gaeagaaLayGteshprvdkisftGstav.ravaraaaknlkpvtlEllgGkspviVladetadldl


                         -         *         -         -         -         -         +:350
query           QRCTAIKRVIVLESVADKLATLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTP
00445741   1/1  dllsnlkpvtlelgGknpvivlddadldlaveaivagaflnaGqvCtapsrllVhesiydefvealveal
00361741   1/1  adldlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgpliseaal
00355651   1/1  iVlddadldlaveaivasaflnaGqvCtaasrllvhesiydefvealvealaklkvgdpldpdtdlgpli
00371931   1/1  qvCtalsrllVhesiadeflealvealaklkvgdplddtdlgplisaaaldrvlgliedavaegaklllg
00417501   1/1  adldlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpgtdlgplisaaql
00357661   1/1  adldlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgplisaaal
00403161   1/1  aveaivagkflnaGqvCtaasrllVhesiadeflealvealaklkvgdpldpgtdlgpliseaqldrvlg
00350371   1/1  dldlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpgtdlgpliseaqld
00348771   1/1  ddadldlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgplisea
00506661   1/1  lnaGqvCtapsrllVhesiydefvealvealaklkvgdpldpgtdlgpliseaaadrvlgliedavaega
00372771   1/1  aelvkaivagkflnaGQvCtapsrllVhesiaydeflealv......kvgdpldpstdlgpliseaqldr
00350031   1/1  naGqvCtapsrllVhesiadeflealvealakl.vgdpldestdlgpliseaalervlglie.....gak
00416701   1/1  dldlaveaivlgkflnaGq.CtalerllVhesiadefleal.............................
00448831   1/1  edadldlavkiivnakffnaGq.CnalerllVhesiadeflealve..........ledtdvgplideaa
00477581   1/1  .....vagaflnaGqvCtaasrllVtdhesiadefvealvealkalkvgdpldestdlgplisadqlerv


                         -         -         -         -         *         -         -:420
query           IKREGNLLWPVLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA
00445741   1/1  aklkvgdpdpdtdlgplisaaaldrvlgliedavaegaklllggerleggyfvePtvltdvtpdmpilqe
00361741   1/1  drvleliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlavvrvddldeaiala
00355651   1/1  saaaldrvlgliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddlde
00371931   1/1  gdrggyfvePtvltdvtpdmpilqeEifgPvlavvrvddldeaielandtgygltaaiftrdlaralrfa
00417501   1/1  drvleliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddldeaiela
00357661   1/1  drvlgliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddldeaiela
00403161   1/1  liedavaegaklllggerlegyfvePtvlevdtdvtpdmpilqeEifgPvlpvvrvddldeaielandte
00350371   1/1  rvlgliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlavvrvddldeaialan
00348771   1/1  qldrvleliedavaegaklllggerlvllgelleggyfvePtvltdvtpdmrilqeEifgPvlavvrvdd
00506661   1/1  kvllggerldleggyfvePtvltdvtpdmpilqeEifgPvlpvvrvddldeaielandteyglaasvftr
00372771   1/1  v...iedavaegakllaggd.ggyfveptvltdvtlelpdmrilqeEifgPvlavvrvddldeaialand
00350031   1/1  vlaggerleggyfvaptvltdvtpdmpilqeEifgPvlavvrvddldeaielandtgygltaaiftrdle
00416701   1/1  ....iedaveegakllagg..kglfvaptvltdvdpdm...qeEifgPvlavirvddldeaielandtgy
00448831   1/1  lervlglielaveeg..........glfvaptvltavdedm...qeEifgpvlavvvvddldeAielind
00477581   1/1  leliddaaaegaelltggprlllggyfvaPtvllg.tpdmeilgeEifGPnhvlPtsglarfssvlsvlr


                         -         -         +         -         -         -         -:490
query           EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK----------------
00445741   1/1  EifgPvlpvvrvddldeaielandteyglaaavftrdleralrvarrleaGr------------------
00361741   1/1  ndteygltaaiftrdlerarrvarrleagrvyvNdpttga.pglpfgGvkes------------------
00355651   1/1  aielandteygltaavftrdlaralrvarrleagrvlvNdpttga.pglpfg------------------
00371931   1/1  rrleagrvlvNdsttgadvglpfgGvkesglgreggplgleeftetktvllglg----------------
00417501   1/1  ndteygltaaiftrdlaralrvarrleagrvyvNdsttg.vpglpfgGvkes------------------
00357661   1/1  ndteygltaavftrdlaralrvarrleagrvlvNdpttg.vpglpfgGvkes------------------
00403161   1/1  ygltaavftrdlaralrvarrleagrvlvNdsttgadgalpfgGvkesglGr------------------
00350371   1/1  dteyglaaaiftrdlaralrvarrleagrvyvNdpttg.vpglpfgGvkasg------------------
00348771   1/1  ldeaielandteyglaaavftrdlaralrvarrleaGrvyvNdpttga.pgl------------------
00506661   1/1  dlaralrvarrleagrvlvNdpltg.vpalpfgGvkesgigreggllgleeft-----------------
00372771   1/1  teygLtaavftrdleralrvallsarrleaGrvyvNdsttgavvgpalpfgG------------------
00350031   1/1  ralrfarrleagrvlvNasttgadvgalpfgGvktsglgreggpvgleeftn------------------
00416701   1/1  gltaaiftedleralrfarrldagivyvNas.......lpfggvkesGlGre------------------
00448831   1/1  tgygltaaifTedleraerfarevdagrvlvNast.......pfggvkesGl------------------
00477581   1/1  fddldeaielan----------------------------------------------------------