[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF55996.1


[Show Plain Result]

## Summary of Sequence Search
   1::798
 254::441  2.9e-44 34.1% 0035848 00358481 1/2   p containing nucleoside triphosphate hy 
 179::448  9.8e-44 30.2% 0038162 00381621 1/2   p containing nucleoside triphosphate hy 
 273::675  3.5e-39 24.6% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
 524::704  3.9e-38 28.9% 0038142 00381422 2/2   p containing nucleoside triphosphate hy 
 251::442  1.2e-37 36.3% 0043258 00432581 1/1   p containing nucleoside triphosphate hy 
 242::444  2.4e-37 33.9% 0052547 00525471 1/2   p containing nucleoside triphosphate hy 
 165::427  4.9e-37 29.7% 0051486 00514861 1/1   p containing nucleoside triphosphate hy 
 216::446  1.2e-34 26.5% 0038151 00381511 1/1   p containing nucleoside triphosphate hy 
 168::446  4.3e-34 28.1% 0038141 00381411 1/2   p containing nucleoside triphosphate hy 
 308::680  9.8e-34 26.4% 0050677 00506771 1/1   p containing nucleoside triphosphate hy 
 281::729  2.9e-33 25.4% 0038163 00381631 1/1   p containing nucleoside triphosphate hy 
 251::441  8.7e-33 25.7% 0036317 00363171 1/1   p containing nucleoside triphosphate hy 
 280::707  1.3e-30 31.6% 0036318 00363181 1/1   p containing nucleoside triphosphate hy 
 259::411  5.3e-28 31.7% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 239::426  9.9e-28 31.4% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
 259::427  2.7e-25 34.7% 0051499 00514991 1/1   p containing nucleoside triphosphate hy 
 228::445  6.9e-25 24.9% 0052855 00528551 1/1   p containing nucleoside triphosphate hy 
 239::443  1.6e-24 30.1% 0043901 00439011 1/2   p containing nucleoside triphosphate hy 
 254::460    3e-24 30.1% 0050676 00506761 1/1   p containing nucleoside triphosphate hy 
 247::677  1.1e-22 28.4% 0041442 00414421 1/1   p containing nucleoside triphosphate hy 
 457::677  8.9e-22 29.3% 0052549 00525492 2/2   p containing nucleoside triphosphate hy 
 239::444  1.8e-20 27.6% 0042553 00425531 1/2   p containing nucleoside triphosphate hy 
 451::692  2.2e-20 25.6% 0052823 00528232 2/2   p containing nucleoside triphosphate hy 
 275::424  7.2e-20 30.1% 0051331 00513311 1/1   p containing nucleoside triphosphate hy 
 475::703  7.6e-20 30.3% 0035849 00358492 2/2   p containing nucleoside triphosphate hy 
 274::423    2e-19 27.2% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
 236::445  3.1e-19 25.5% 0038740 00387401 1/2   p containing nucleoside triphosphate hy 
 452::696  1.3e-18 22.6% 0053147 00531472 2/2   p containing nucleoside triphosphate hy 
 233::445  1.6e-18 26.4% 0053146 00531461 1/1   p containing nucleoside triphosphate hy 
 375::674  1.8e-18 27.5% 0052795 00527952 2/2   p containing nucleoside triphosphate hy 
 230::443    5e-18 25.6% 0042720 00427201 1/2   p containing nucleoside triphosphate hy 
 239::445  4.4e-17 26.7% 0049300 00493001 1/1   p containing nucleoside triphosphate hy 
 238::445    3e-16 22.7% 0042088 00420881 1/2   p containing nucleoside triphosphate hy 
 237::442  9.2e-16 26.0% 0044714 00447141 1/2   p containing nucleoside triphosphate hy 
 148::444  6.5e-15 22.4% 0048111 00481111 1/1   p containing nucleoside triphosphate hy 
 556::697  9.7e-15 22.9% 0041443 00414432 2/2   p containing nucleoside triphosphate hy 
 590::697  3.8e-14 24.0% 0037787 00377872 2/2   p containing nucleoside triphosphate hy 
 281::366  1.4e-13 34.9% 0037787 00377871 1/2   p containing nucleoside triphosphate hy 
 286::387  6.2e-13 28.4% 0052549 00525491 1/2   p containing nucleoside triphosphate hy 
 282::366  7.1e-13 35.7% 0038741 00387411 1/2   p containing nucleoside triphosphate hy 
 374::671  9.3e-13 24.7% 0051498 00514982 2/2   p containing nucleoside triphosphate hy 
 280::366  5.8e-12 32.6% 0035849 00358491 1/2   p containing nucleoside triphosphate hy 
 557::701    1e-11 23.8% 0049301 00493012 2/2   p containing nucleoside triphosphate hy 
 590::705  1.1e-10 25.0% 0042089 00420892 2/2   p containing nucleoside triphosphate hy 
 276::366  4.8e-10 31.8% 0052823 00528231 1/2   p containing nucleoside triphosphate hy 
 590::676  5.9e-10 30.7% 0043887 00438872 2/2   p containing nucleoside triphosphate hy 
 219::444  8.2e-10 23.0% 0050691 00506911 1/1   p containing nucleoside triphosphate hy 
 590::689    1e-09 22.7% 0038741 00387412 2/2   p containing nucleoside triphosphate hy 
 521::679  1.6e-09 22.1% 0040826 00408262 2/2   p containing nucleoside triphosphate hy 
 280::366  5.2e-09 34.9% 0043887 00438871 1/2   p containing nucleoside triphosphate hy 
 261::335    1e-08 33.8% 0049837 00498371 1/1   p containing nucleoside triphosphate hy 
 279::366    1e-08 29.1% 0042089 00420891 1/2   p containing nucleoside triphosphate hy 
 282::366  2.4e-08 30.7% 0038142 00381421 1/2   p containing nucleoside triphosphate hy 
 599::675  2.5e-07 39.7% 0042720 00427202 2/2   p containing nucleoside triphosphate hy 
 590::746  2.7e-07 20.8% 0051332 00513322 2/2   p containing nucleoside triphosphate hy 
 251::333  9.3e-07 28.9% 0048956 00489561 1/1   p containing nucleoside triphosphate hy 
 259::346  1.1e-06 30.0% 0050350 00503501 1/1   p containing nucleoside triphosphate hy 
 594::670  1.1e-06 31.3% 0039715 00397152 2/2   p containing nucleoside triphosphate hy 
 274::366  1.8e-06 25.6% 0053147 00531471 1/2   p containing nucleoside triphosphate hy 
 559::663  2.8e-06 26.9% 0051485 00514852 2/2   p containing nucleoside triphosphate hy 
 274::366  3.5e-06 26.1% 0041443 00414431 1/2   p containing nucleoside triphosphate hy 
 559::674  8.4e-06 28.6% 0043901 00439012 2/2   p containing nucleoside triphosphate hy 
 557::665  6.6e-05 35.0% 0042088 00420882 2/2   p containing nucleoside triphosphate hy 
 283::366   0.0004 23.5% 0049301 00493011 1/2   p containing nucleoside triphosphate hy 
 255::370  0.00048 27.8% 0051485 00514851 1/2   p containing nucleoside triphosphate hy 
 274::366  0.00064 23.9% 0040826 00408261 1/2   p containing nucleoside triphosphate hy 
 595::663   0.0037 34.4% 0034833 00348332 2/2   p containing nucleoside triphosphate hy 
 291::366   0.0056 32.4% 0052795 00527951 1/2   p containing nucleoside triphosphate hy 
 559::629   0.0076 31.0% 0035848 00358482 2/2   p containing nucleoside triphosphate hy 
 289::370     0.01 25.6% 0051498 00514981 1/2   p containing nucleoside triphosphate hy 
 563::622    0.015 33.3% 0052547 00525472 2/2   p containing nucleoside triphosphate hy 
 594::664    0.023 26.5% 0036155 00361552 2/2   p containing nucleoside triphosphate hy 
 273::366    0.044 29.8% 0039715 00397151 1/2   p containing nucleoside triphosphate hy 
 282::366    0.063 34.2% 0034833 00348331 1/2   p containing nucleoside triphosphate hy 
 559::622     0.13 26.6% 0038162 00381622 2/2   p containing nucleoside triphosphate hy 
 599::665     0.91 46.8% 0042553 00425532 2/2   p containing nucleoside triphosphate hy 
 296::366      1.1 31.7% 0036155 00361551 1/2   p containing nucleoside triphosphate hy 
 599::669      1.5 41.2% 0044714 00447142 2/2   p containing nucleoside triphosphate hy 
 285::365        4 24.3% 0051332 00513321 1/2   p containing nucleoside triphosphate hy 
 599::622        5 62.5% 0038740 00387402 2/2   p containing nucleoside triphosphate hy 
 563::622      9.6 31.0% 0038141 00381412 2/2   p containing nucleoside triphosphate hy 
   1::798


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEMEQDLKD
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKILYPLEGLSQEERVRLFGSEDS
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LAFSSLDLGKQAEMMRLTRKGLLGLEYQAVDQKKVKTQSWYEVDHAQLEGVEISTRAKKKLELRDYLLSH
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  --------------------------------------eylpvdllllvslleleeallliklpsdlwek
00520041   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ------------------------ldgdlaellealldllieelerlllglllkrelldllrlpdlflll
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ---------------------------lllgelvllklklkellrelleillelealrkplesfedlglp
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  -------lelllkllgllnlrelkkllkivdkinslepalerlsdeellaktlelklrlaeg........
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PESASLASLLESYSREQVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
00358481   1/2  -------------------------------------------lkalgpfeltpiQqeaipaileglesg
00381621   1/2  lkaklrlileellllelellllellrllisfedlglleelleelkellplkltpiQkeaipelleglesg
00520041   1/1  --------------------------------------------------------------iipallsg
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------leallkfgffelrpyQkeaiealle.....
00525471   1/2  -------------------------------deelldalkrllleellllalelllllalldllsfeelg
00514861   1/1  elpellpf..........................................elrpyQleavnwllervldl
00381511   1/1  -----lllillelllalarllleellldllkldlilpeesfeelgldpellealkk.gffeltpiQkeai
00381411   1/2  ellleal......................................kklgfeltpiQkeaipailk.....
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------ikplklispfeprpyQqeaiealleglekg
00363181   1/1  ---------------------------------------------------------------------e
00503561   1/1  ------------------------------------------------kPydrLldivgigfltaddial
00527961   1/1  ----------------------------Likkllkdllilllklgellleallellleellllallllel
00514991   1/1  ------------------------------------------------lellidlglpfelrpyQleave
00528551   1/1  -----------------lvegldlplpllsfedlglspellealkklgfekptpiQaeaipaileg....
00439011   1/2  ----------------------------ksfeelglseellkallelgfleltpiQleaiplils.....
00506761   1/1  -------------------------------------------lllelgflelrpyQleaipalle....
00414421   1/1  ------------------------------------saellealkrllffrltpiQleaipallsgr...
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------ksfeelglseellkalkklgflkptpiQaeaipaileg....
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------elales
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ---------------------------------------------------------------ilealrs
00387401   1/2  -------------------------epllsfeelglseellealkklgflkptpiQleaipaileg....
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------elllllvllsdlplpllsfedlglseellkalkklgfekptpiQaeai
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  -------------------llselllpvlsfedlglseellkalkklgfeeptpiQaeaipaileg....
00493001   1/1  ----------------------------lsfedlglseellkalkelgfekptpiQaeaipaile.....
00420881   1/2  ---------------------------llsfedlglseelldalkelfgfteltpiQaeaipaile....
00447141   1/2  --------------------------pvlsfeelglseellkalkklgfleptpiQaeaipaile.....
00481111   1/1  ..........................esldflllelsalllealkrllffrptpiQllaipallegr...
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ---------------------------------------------------------------------s
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  -----------------------------------------------------------------llppg
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  --------lllllellilvegllvptpllsfeelglspellealkklgfekptpiQaeaipaile.....
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ---------------------------------------------------------------------s
00498371   1/1  --------------------------------------------------kLnpeQreairaa.......
00420891   1/2  --------------------------------------------------------------------pp
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------llaliedilatlnpeQreavraa.......
00503501   1/1  ------------------------------------------------p.tlnpeQrea.......irap
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ---------------------------------------------------------------esltpen
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ---------------------------------------------------------------rpvtrkd
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  --------------------------------------------TkkdvlkdLppkieivvyvelspeqk
00408261   1/2  ---------------------------------------------------------------iplvrli
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  --------------------------------------------------------------llesltle
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
00358481   1/2  prdvllvgptGtGKTltaaalalel...gkqvlvlaptrelaeqlaeelrelfpelpvilfldeidalpp
00381621   1/2  kpknvllagptGsGKTlvallailelllrgkqvlvlvPtralaeqlaeefkklfgllglrvgllhgglsk
00520041   1/1  rdvvllaaptGsGKTlaallpilelllegggrvlvlaPtralaeqvaeelr............gltgger
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  gknvllvapTGsGKTlvallailellerngkkvlvlvPtraLaeqiaeelkklfgilglkvavltgglsk
00525471   1/2  ldeellealkklgffelrpyQleaipallegresglpmdvllaaptGsGKTlvallailelllrgkrvlv
00514861   1/1  llgkgrgglladetGsGKTlvalllilelllrgklkgplakrvlvvvPt.sLaeqwleefkkffpgllkv
00381511   1/1  pailk.....grdlllvapTGsGKTlaallpalelllkgkrvlvlaPtrelaeqiaeelrkllgflgldl
00381411   1/2  gedvllvapTGsGKTlaallpaleallkgkrvlvlaptrelaeqiaeelrkllgelggdlklkvallhgg
00506771   1/1  ---------------------------kgkralvlaPtreLalqiveelkkllpllglglrvallvggts
00381631   1/1  grdvllaapTGsGKTlaallpilllllrgkrvlvlaPtreLaeqiaeelkkllg................
00363171   1/1  kknvllvgptGtGKTltaaalaael...gkpvlivaptkeladqlyeelkkllpelkvellhggldylqk
00363181   1/1  gkdvllvapTGsGKTlvallpallrllekgkrvlvlvptrelalqlaeelkkl.................
00503561   1/1  algiagdsperlllalallsellgeghlylplddlveellklleldelllelieleellkelleeilvel
00527961   1/1  lelleklllflllllpelleellkllgfelrpyQleaiealleg.....rdvllagptGsGKTlvallli
00514991   1/1  allell.ekgrgglladptGsGKTlvalllilellergpakrvlvvvP.rslaeqwaeelkkflpglkvg
00528551   1/1  .rdvlvqapTGsGKTlafllpilqlllklpkgpralvlaPtrelalqiaeelkkllkllglrvalltggl
00439011   1/2  grdvllqapTGsGKTlafllpilqlllkklkggqvlifvptrelaeqlaevlrellkflpglkvallhgg
00506761   1/1  .g.dvllaaptGsGKTlaallpilelllrggkrvlvlvPtrelaeqwaeelrkllgllglkvglltggls
00414421   1/1  ....lleapTGsGKTlaallpallallngkgvlvitPtreLaeqiaeelrellkflglkvglltgglslk
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  .rdvlvqapTGsGKTlafllpileallkllkggkalvfaptrelaeqlaeelrklgkelglllgikvall
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  grdvllvaptGsGKTlaallpilellllrggrvlvlaPtrelalqvaeelr...glkvglltgglslker
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  grvvllvgptGsGKTtlalalalel...ggrvlvlvptralaeqlaerlakllglrvgllvgylirfes.
00387401   1/2  drdvlvvapTGsGKTlaallpllelllkepggkvlvfvptrelaeqlaerlkkllkllglkvgllhggls
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  paileg.....rdvlvqapTGsGKTlafllpilqlllklpkgpralvlaPtrelalqiaeelkkllkllg
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  .rdvlvqapTGsGKTlafllpllelllkllkggqalvfvptrelaeqlaeelrkllkllgikvallhggl
00493001   1/1  grdvlvqapTGsGKTlafllpilllllkepkgpralvlaptrelalqiaevlrkllkllglrvalltggl
00420881   1/2  .grdvlvvapTGsGKTlayllpall...rggkvlvfvptrelaeqlaeelrkl.girvallhgglsqeer
00447141   1/2  grdvlvvapTGsGKTlafllpllelllkepkggkalvfvptrelaeqlaevlrkllklllgikvallhgg
00481111   1/1  ....laqapTGsGKTlaallpallallagkqvlvvtptreLaeqvaevlkklleflglsvglltgglslk
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  grdvllvaptgsgKtlallpllakl..kggrvlvlaptrelaeqlaellke.lgikvavlhgglsqeere
00525491   1/2  -----rPvdrlqlvivvgsgkklvlllallkelekggqvlvfvptrklaeqlaelLrellpgirvallhg
00387411   1/2  -rdvlvqaptgsgktlkllpllelllekggrvlvfvptrelaeqlaellrkl.gikvavlhgglsqeere
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  grdvlvvapTGsGKTlaallpalllllalgkqvlvlvPtrktaeelaellre.lgikvaalhgdlsqeer
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  llqqllvvvtesgkleallellkel..kggqvlvfvptrelaeqlaelLrel.gikvallhgglsqeeRe
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  grdvlvvapTGsGKTlafllpilqlllklllllllllklkgpralilaPtreLalqiaeelkkllkllgl
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  grdvlvvaptgsgktllfllpall...kggrvlvltptrelaeqlaevlrkl.gikvavlhgglsqeere
00498371   1/1  ggpllvqGppGTGKTttlvariaylllegglppkrilvvtftnaaadelrerllk---------------
00420891   1/2  drlrqvlvvvgtgkklslllqllkll.kggqvlvfvptrelaeqlaelLrel.gikvaalhgglsqeere
00381421   1/2  -rpnltqlviyvgseekleallsll...gkkvlifvptrklaeelaelL.......vavlhgglsqeeRe
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ggplliqGgpGTGKTttlveriayllleggvppkrilvvtftnkAadelrerl-----------------
00503501   1/1  lkgpllvqGgaGtGKTttlvhriarlllngvpeslkekrvpperiLvvtfTnkAadelrerlrkll----
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  llqivlvvveesgklelllellkel..rggkvlvfcntrklaellaelLrel.gikvavlhgglsqkere
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ipqlvyvt..gsgkklalllellellergqpvLvftptrelaeqlaelLrkl.gikalvlhgglsqeere
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  --sltppnlkqivivveesdklelllellkel..rggkvlvfcntrktaeelaelLrel.gikvaalhgg
00514851   1/2  elyeallkgkdllliiideagktlvlnlllllrkicnhpvLllekllsasqgfedflpdilqllplllll
00408261   1/2  kqdvlv..vteegklkallellkellaegeqvlvftptielaellaelLkel.gipaavlhgdlsqeere
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------ssgkleallellkel..kgkqvlvfvntrelaeqlaell......gvallhgdlsqkere
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  --------veesgKleallellkellekgekvliFsqtkdtldllaelLrkllgikvarlhgdlsqkeRe
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  niaqlvllvdgslklllllllllll..rggqalvfvptrelaeqlaellrkl.gikvlalhgglsqee..
00348331   1/2  -rpviaqavtgtgk.afklplllrllevlkggqalvfcptreladqlaeeLrk.rglkvlalhggls...
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ---------------evkldlllrllevlrggsalvFcptreeaeqlaeeLrel.glkalalhGgls...
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----Grlspvetlyrpilsvevvvleekleallellkel...ggsvlvFvnsrkeveelaelLrkl.gik
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
00358481   1/2  erlspssdviirvallhgglseaerlealrallegeadilvaTvgrlldlldpallrlgrldllvgdead
00381621   1/2  kereeileklrsgeadilvgTpellfdllrlknlglviiDEahrlgvkqr..........eillslldnv
00520041   1/1  vrllerllsgeadilvgtpgrlldlllrdlllrnldlviiDEahrl.....dlgfgpllrlllellprpd
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ker..lr.....gdadivvaTperldsllrrllddlglviiDEaHrlldkg....fgpileli.....lk
00525471   1/2  lvPtrelaeqwaeelkkllpelglkvallhgglsqkereealekfksgeadilvaTpgrllrgldlpnld
00514861   1/1  lvltgglsakerkelleklasgepllkadivittyqlllkdleflslrnldlviiDEaHr..lknfgskl
00381511   1/1  elkvallhgglslkereealedl..geadilvaTpgrlldllrdlknldlvilDEahrlldeqrgpllel
00381411   1/2  lslkereealerf..geadilvaTpgrlldgldrlknldlviiDEahrlldsqrgpllellllgflsqlr
00506771   1/1  lkerleilkkllsg.adilvaTpgrlldllelsnldllviDEaHrlldmg...frkllrrl.......pd
00381631   1/1  ......................................................................
00363171   1/1  ealfpeidtlpykdaspneeidlerlsallallegepdivvatvqalldlpkpellllltltllvgdeld
00363181   1/1  ......................................................................
00503561   1/1  lkedlelvlderrlyleeleldelglaellkelleeleideklldkilddlegilplnpeQ---------
00527961   1/1  lel...gkrvlvlaPtraLaeqwaeel.kflglklvglltgglslke.............divitTpgrl
00514991   1/1  vltgglkl.........lllgkadivittyelllrllelknlkfdlviiDEaHrl..knrgsklrealka
00528551   1/1  slkerleall...rggadilvaTpgrlldllrrglldlsnlkllvlDEadrll...dmgfgpdlrkilrr
00439011   1/2  lsqker...leafkkgkvdilvaTpgrllddllargldlpnvdlvildeahrig....rtgrfgrkglai
00506761   1/1  lkerleal.....ggadilvttpgrlldlllrdllllsnldlvilDEaH.rlldlgfgpll....lkilr
00414421   1/1  err......laggadilvgTpgrllddllrdnlalslgllvlrnldllviDEahrllvdegfrplilsi.
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  hgglsqkerlralk....gkadilvaTpgrllddlaargldlpnvdlvilDeahri....grtgrggdlg
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  letl.........ilvatpgrlldlllrdlllsnldllvlDEahll.....dlgfrlllelllellplpd
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ...trilvvtyglllrll...dlllsdfdliiiDEahelsaetdlllglllelle....lrpdlkvllls
00387401   1/2  qkerlral.....gkadilvaTpgrllddlaargldlpnvdlvilDeahrlg....rtgrggllgkilll
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  irvalltgglsikerlralk....ggadilvaTpgrlldlllrglld..lsnlklvvlDEadrll...dm
00527952   2/2  ------------------------lsnlgllvlDEahrlld..gfgpqlr....kilellpkarqvllls
00427201   1/2  sqkerleil.....gkvdilvaTpgrllddlaargldlpnvdlvilDEadrl.....lnydfplslesyl
00493001   1/1  slkerlralk....ggadilvaTpgrlldlllrrgld..lsnlkllvlDEadrll...dlgfgpdlrli.
00420881   1/2  ervleafrsgkadilvaTpgrllddllargldlpdvdlvilDEahrlld.lgksfepyvqrigragragk
00447141   1/2  lsqeerlrvlk....gkvdilvaTpgrllddlaargldlpdvdlvvlDeahrig....rtgragdlgkil
00481111   1/1  err......laggadivvgTpgrllddylrdnhllrqedlvlrnlsllviDEaDrllddgfrtlliiilk
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  eilerfrsgeikvlva------------------------------------------------------
00525491   1/2  dlsqeereevleafrngeidvLvaTdvaarGldipdv---------------------------------
00387411   1/2  evleafrsgkidvLva------------------------------------------------------
00514982   2/2  -----------------------klsnwdllvlDEahrl.....lnmgfrsqirkilkllpkarqrlllt
00358491   1/2  eeiledfrngeidvLv------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  eilerfrsgeidvLva------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  rvalltggtsldeqiralkk....gpdilvaTpgrlldllrrgkld..lsnlkllvlDEadrlldmg..f
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  eileafrngeidvLva------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  evlerfrsgeidvLva------------------------------------------------------
00381421   1/2  eilekfrngeidvLva------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  eiledfrsgeidvLva------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ivleafrkg..dvlvA------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  lsqeeReeiledfrng------------------------------------------------------
00514851   1/2  veesgKleallellkellie--------------------------------------------------
00408261   1/2  ivleafrsg..dvlva------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  eiledfrngeidvLva------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  eildrfrngedviviLvstd--------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  .....flsggvdvlvA------------------------------------------------------
00348331   1/2  ....qrrflkgkvdvl------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ....qrrflngkvdvl------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  vavlhGg....erek-------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV
00358481   1/2  ldellktllelGydrvdlvle-------------------------------------------------
00381621   1/2  qvlllsATpipntldlalsllrfllvid------------------------------------------
00520041   1/1  lqllllSATpppe...........................eltlpllrldvllveeslklelllellell
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  naqvlglsATpinprdlaellk------------------------------------------------
00525471   1/2  lviiDEah..........rlgfrd----------------------------------------------
00514861   1/1  rkalkrl---------------------------------------------------------------
00381511   1/1  llmgflsqlreilralpadvqvlllS--------------------------------------------
00381411   1/2  eilralppdvqvlllSATpppnvlel--------------------------------------------
00506771   1/1  rqvlllsATpipnvlelllsllgllvp..............dllkqfvlvvlke..ekleallellkell
00381631   1/1  ......................................................................
00363171   1/1  ldellerLvelgYervdlvlr-------------------------------------------------
00363181   1/1  ......................................................................
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ldlldl----------------------------------------------------------------
00514991   1/1  l......---------------------------------------------------------------
00528551   1/1  lp..kdrqtlllSATlpnevlelak---------------------------------------------
00439011   1/2  llllpkerqtlllSATlpeelle-----------------------------------------------
00506761   1/1  rlrpdlrvlllsATpiqnvlelasllglpvpiilgrlapv------------------------------
00414421   1/1  ......................................................................
00525492   2/2  ------------------------------------rPvdrlqlvivvgsgk.klvlllallkelekggq
00425531   1/2  lillllp.pdrqtlllSATlpnev----------------------------------------------
00528232   2/2  ------------------------------llppgllqqllvvvte..sgkleallellkel..kggqvl
00513311   1/1  lqll------------------------------------------------------------------
00358492   2/2  ------------------------------------------------------llpalllllalgkqvl
00348321   1/1  ATp-------------------------------------------------------------------
00387401   1/2  lp.pdlqvlllSATlppnvlelakl---------------------------------------------
00531472   2/2  -------------------------------esltpenllqivlvvveesgklelllellkel..rggkv
00531461   1/1  gfgpdlrlilrrlp..pdrqtllfS---------------------------------------------
00527952   2/2  ATpirevlllallllldpvvievl...........pelikqvvlvvpssgkleallellkel..kgkqvl
00427201   1/2  qrlgrtgrtlllSATagneglal-----------------------------------------------
00493001   1/1  .lrrlpkdrqtlllSATlpnevlel---------------------------------------------
00420881   1/2  dgqalllsATltpevlellrlllkl---------------------------------------------
00447141   1/2  lllp.pdrqtlllSATlpnevl------------------------------------------------
00481111   1/1  llktlasitlqnlfrldrqlllfs----------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  aTpiq...............lllllldpvli........dqllllveesgKleallellkellekgekvl
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  gpdlelilsrlprllgkdrqtllf----------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  lelggkvlvfvnsreeaellaellre............................................
00381422   2/2  ---------------------------------rpnltqlviyvgseekleallsllgkkvlifvp..tr
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  algrggkvlvfvntrkta....................................................
00381631   1/1  ......................................................................
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ......................................................................
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00525492   2/2  vlvfvptrklaeql........................................................
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  vfvptrela.............................................................
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  vlvPtr................................................................
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  lvfcntrkla............................................................
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  vfvntr................................................................
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  -----------------------------------------------------------------ftptr
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  iFsqt................................................................k
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ------------------------------------------------------------------cntr
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ------------------------------iplvrlikqdvlvvteegklkallellkellaegeqvlvf
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  --------------------------------------------------------------------tr
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  --------------------------------------------------------------------ae
00420882   2/2  ------------------------------------------------------------------vptr
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  --------------------------------------------------------------------ae
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  --------------------------------------------------------------------ae
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADILLGTQMIAKGLDFPNVTLVGVLNADTA
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  ..................lgikvlvlhgglsqeereevle......geikvlvatdvlerGlDi.dvdlV
00381422   2/2  klaeelaelL..vavlhgglsqeeRee....ilekfrngeidvLvaTaslldvlarGlDipdrvdlViny
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  ............ellaelLrelgikvaalhgllssssllglsqeereeiledfrngeidvLvatdvlerG
00381631   1/1  ..aeelaellkgikvallhgglsqee..reevleafrsgeidvLvaTdvlerGlDipdvdlViiydlpk.
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ............gikvavlhgdlsqke..reeiledfrngeidvLvatdvlarGlDipnvdlViildlpk
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00525492   2/2  ....aelLrellpgirvallhgdlsqee..reevleafrngeidvLvaTdvaarGldipdvdlViiydlp
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ...eqlaelLrelgikvallhgglsqeeReeilerfrsgeidvLvaTdvaarGlDipnvdlVin......
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  ktaeelaellrelgikvaalhgdlsqeereeiledfrngeidvLvatdvlarGlDipdvdlvinldlpkl
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ellaelLrel..gikvavlhgglsqke..reeiledfrsgeidvLvaTdvlarGlDipdvdlVinydlpk
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  elaeqlaell...gvallhgdlsqke..reeiledfrngeidvLvatdvlerGiDipdvdlvinldlpk.
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  elaeqlaelLrklgikalvlhgglsqeereivleafrkg..dvlvATdvagrGlDivLgpgvdlvinydl
00377872   2/2  -----------------------------eeilerfrsgeikvlvaTdvlerGlDipdvdlViiydlpk.
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  dtldllaelLrkllgikvarlhgdlsqkeReeildrfrngedviviLvstdaagrGlnltganhVinydl
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ktaeelaelLrelgikvaalhgglsqeeReeiledfrngeidvLvaTdvlarGiDipdvdlVinydlpk.
00420892   2/2  -----------------------------eevlerfrsgeidvLvaTdvlarGiDipnvdlVinydlpk.
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  -----------------------------eeileafrngeidvLvaTdvlgrGldipdvdlVinydlpk.
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  -----------------------------eevleafrsgkidvLvaTdvlgrGidlpdvdlViiydlpk.
00408262   2/2  tptielaellaelLkelgipaavlhgdlsqeereivleafrsg..dvlvaTdvagrGlDipnvsvvlelG
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  --------------------------------------gkvdilvaTpgrllddlaargldlpnvdlvil
00513322   2/2  -----------------------------ekvlelfkngkikvlvATdvaerGiDi.dvdl..Vidyglp
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ---------------------------------eeflsggvdvlvATdvaerGld.pdvdlVinydldll
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  etlellaelLrelgikvarlhGglsqeeReeiierFrdpdgeirvfLvstdaggeGlDlpdadtviildp
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  qlaevlrellkflpglkvallhgglsqker.....leafkkgkvdilvaTpgrllddllargldlpnvdl
00420882   2/2  elaeqlaeelrklgirvallhgglsqeerervleafrsgkadilvaTpgrllddllargldlpdvdlvil
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------rflkgkvdvlVATdvaerGiD.pdvdlVidydlvkv
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  qlaeelrelfpelpvilfldeidalpperlspssdviirvallhgglseaerlealrallegeadilva-
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  --aeelkkllpelglkvallhgglsqkereealekfksgeadilvaTpgrllrgldlpnldl--------
00361552   2/2  ---------------------------------rrflngkvdvlVATdvaerGiD.pdvdfVidydl.vk
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  qlaeefkklfgllglrvgllhgglskkereeileklrsgeadilvgTpellfdllrlknlgl--------
00425532   2/2  --------------------------------------gkadilvaTpgrllddlaargldlpnvdlvil
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  --------------------------------------gkvdilvaTpgrllddlaargldlpdvdlvvl
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  --------------------------------------gkadilvaTpgrllddlaargldl--------
00381412   2/2  --aeelrkllgelggdlklkvallhgglslkereealerf..geadilvaTpgrlldgldrl--------


                         -         +         -         -         -         -         *:700
query           LNLPDFRSSERTFQLLTQVAGRAGRAEKAGQVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPP
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  iiydlvkldvllldldlglvllllr..plslasyiQriGRagR.g-------------------------
00381422   2/2  dapkflvklkellkllgllldlllllatliddllrllllllevieeirellkellldeevlekllnlpdf
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  lDipdvdlvinydlpk............slasyiQriGRagRagk.glvi--------------------
00381631   1/1  ...........slesylQrirGRagRagrdglaillvspedlkllkal..eellelllelllleldllll
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  lllllsle.......lyiQriGRagRagkkglaillvtledllllrallellkral...ellvllllgli
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  .................vdtvinydlpnsledylqriGRtgRagteg-----------------------
00525492   2/2  rsl...........esylhQraGRagRagkkglaillvtpddllllr-----------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ydlprnpalelslesyvqriGRagRagkkglaillvtpddlelllallellklgleeaeldl--------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  lllq.......slelyiQriGRagRagkkglaillvllddllllallelllrral...ellglellglpp
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ............slelyiQriGRagRagqkgeaillvlpedltlleaieellgfklalldlelrgl----
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ...........slesyvQriGRagRagkkglaillvdpddlell--------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  pkspesyvhrildllrigqlklvlvkllvldeadevldlGglhvigterhesrrilnQlrGRtGRag---
00377872   2/2  ...........slasyiQriGRagRagqkglvillldeadlllleallellrrklelldlelrglge---
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  p............wnpavyvQrigRagRiGqkgdvtvyrlv-----------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ...........slesyvQriGRagRagqkglaillvtpedlsllealeellgfklalldlelrglgellg
00420892   2/2  ...........spedyiQriGRagRagqkglaillvtpedltllekllellleklsllelaledlllrgi
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ...........spesyiQriGRagRagqkglailllspedllllra------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ...........spesyiQriGRagRagqkglaillldeadrtllekllellekklellp-----------
00408262   2/2  gllVinydlpk............sleiyvQriGRagRagdkglailfvs---------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  DEadrllnydfplslesylqrl....grtgrtlllSATagnegla-------------------------
00513322   2/2  lkvkvfdgrtgverletrpislasyiQraGRaGRagkpvGtaillydeldldaipeilrteleelvlqlk
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  l........plslesyvqriGRtGR.gkpglaillvsped------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  pw............npaqyiQriGRagRiGqkk-------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  vild....................eahrigrtgrfgrkglaill--------------------------
00420882   2/2  DEahrlldlgk......sfepyvqrigragragkd-----------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  pvldvdtgptlllllvtlpi......slesyvQ-------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  vpvldpdtrptlvislvvvpislesyiQRiGRaG------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  Deahri....................grtgrggdl-----------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ...D.................eahrigrtgragdlgkil-------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           YYFTIGITLSHKKEEEVFKRAYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPT
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381422   2/2  rale------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  lagelllellsglielllldlflellell-----------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  laellle---------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  fll-------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  t---------------------------------------------------------------------
00420892   2/2  lellg-----------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  llgnllgdllslalldppirgallalgllqslgalddleltdlglh------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LNQVLALTQERENSELRLSIDHEPQQFL------------------------------------------
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00432581   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00528551   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00531461   1/1  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00493001   1/1  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00514982   2/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00506911   1/1  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00513322   2/2  ----------------------------------------------------------------------
00489561   1/1  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00514981   1/2  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00513321   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------