[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56069.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
   1::310 5.9e-110 50.3% 0047912 00479121 1/1   hofructokinase                          
   1::303 5.9e-106 52.6% 0045548 00455481 1/1   hofructokinase                          
   1::320   1e-100 49.2% 0042288 00422881 1/1   hofructokinase                          
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
00479121   1/1  selqklrllylpelplllknvaslielkdfeealllrdlsfleklfpnllglplllagprekilfeskkk
00455481   1/1  vkriailtsGgdapGlnavirgvvraalllglevlgilnGyeGLlegdiieldledvsgilnlGGtilgs
00422881   1/1  elkkiailtsGgdapGlnavirgvvraalllglevygilnGyeGLlegdiieldledvsgilnlGGtilg


                         -         -         *         -         -         -         -:140
query           ARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
00479121   1/1  rigiltsGgdaPGlNavirgvvraalllngglevygirnGyeGLlegdiieltwedvsgilntGGtiLgt
00455481   1/1  srlkpflgeeglekaaenlkklgidaLvviGGdgsltgaalLaelgipvvgiPkTidnDlpgtdytiGfd
00422881   1/1  ssrlklflneeglekaaenlkklgidaLvviGGdgsltgaalLaeegipvvgvPkTidnDlpgtdytiGf


                         +         -         -         -         -         *         -:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
00479121   1/1  srrklfeteedlekiaetlkklgidaLvviGGdgsltgaalLaeefekrglgipvvgvPkTIdNDlpneg
00455481   1/1  TAlntiaeaidnirltaashnrvfvvevmGrhaGylAlaaalatgadlvlipEepfdleelldlvlerlk
00422881   1/1  dTAlntiaeaidnirltaashnrvfvvevmGrhaGylAlaaalatgadlvlipEepfdldellelvlerl


                         -         -         -         +         -         -         -:280
query           CGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGI
00479121   1/1  tdysiGfdTAvntiaeaidnirtdassahkrvfvvevmGrhaGwlAleaalatgadlilipEepfdlell
00455481   1/1  rgkgygiivvaEgaldalllaklikeelg.fetrvtvlgylqRgglPsafDrvlatrlgvlAvelllegl
00422881   1/1  klgkgygiivvaEgaldalllaklikeelg.fetrvtvlgylqrgglPsafDrvlatrlgvlAvellleg


                         -         *         -         -         -         -         +:350
query           GGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS---------------
00479121   1/1  ledvveliadvilkrrlkgkgygvivvaEG----------------------------------------
00455481   1/1  tgvvvgirgnkivlvpllelvnl-----------------------------------------------
00422881   1/1  ltgvvvgirgnkivlvpllelvdlekrvpkelillallll------------------------------