[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56087.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  63::283  1.6e-55 38.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  63::280  1.4e-41 36.7% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
   1::62   3.7e-18 41.9% 0049576 00495761 1/1   ic acid-binding proteins                
  58::275  5.8e-18 27.3% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
   1::62     2e-15 30.6% 0044179 00441791 1/1   ic acid-binding proteins                
 143::293  6.3e-09 22.4% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 148::210  1.7e-07 37.5% 0047127 00471272 2/2   p containing nucleoside triphosphate hy 
 149::208  8.4e-07 33.3% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 149::210  1.6e-06 37.7% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 129::237    2e-06 30.4% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
 151::220  8.8e-06 32.9% 0036958 00369582 2/2   p containing nucleoside triphosphate hy 
 143::210  8.9e-06 33.8% 0043218 00432182 2/2   p containing nucleoside triphosphate hy 
 148::181  1.5e-05 44.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 142::216  1.6e-05 33.3% 0040984 00409842 2/2   p containing nucleoside triphosphate hy 
 147::220  1.6e-05 31.1% 0036239 00362392 2/2   p containing nucleoside triphosphate hy 
 149::237  3.3e-05 30.5% 0048819 00488192 2/2   p containing nucleoside triphosphate hy 
 150::169  3.4e-05 55.0% 0051376 00513762 2/2   p containing nucleoside triphosphate hy 
 149::210  4.1e-05 32.8% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 151::220  4.2e-05 31.4% 0037248 00372482 2/2   p containing nucleoside triphosphate hy 
 147::181  4.5e-05 37.1% 0041412 00414122 2/2   p containing nucleoside triphosphate hy 
  92::181  5.1e-05 30.3% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
 151::220  5.5e-05 30.0% 0046936 00469362 2/2   p containing nucleoside triphosphate hy 
 149::182  6.1e-05 35.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 150::210  6.2e-05 27.6% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
 144::180  6.6e-05 37.8% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 150::181  9.7e-05 37.5% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  73::219  0.00013 29.1% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
 150::220  0.00018 28.2% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
 148::180  0.00019 36.4% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
 107::180  0.00022 32.8% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
 143::180  0.00023 42.1% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 147::201  0.00024 40.8% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
 149::210  0.00024 31.0% 0048180 00481802 2/2   p containing nucleoside triphosphate hy 
 148::210  0.00026 30.5% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
 149::181  0.00026 39.4% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
 151::220  0.00034 25.7% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
 149::180  0.00035 37.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 148::210  0.00036 30.9% 0044740 00447402 2/2   p containing nucleoside triphosphate hy 
 140::210  0.00037 25.0% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
 149::210  0.00042 30.8% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 149::180  0.00044 37.5% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 151::220  0.00045 34.3% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
 149::176  0.00046 35.7% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
 126::220  0.00047 22.1% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
 151::210  0.00051 35.0% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 149::182  0.00057 41.2% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
 140::181  0.00061 34.1% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 148::181  0.00064 32.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 150::220  0.00066 31.7% 0052691 00526912 2/2   p containing nucleoside triphosphate hy 
 153::220  0.00066 27.9% 0039672 00396722 2/2   p containing nucleoside triphosphate hy 
 143::180  0.00068 36.8% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 150::210  0.00071 28.1% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
 148::220  0.00072 35.6% 0051769 00517692 2/2   p containing nucleoside triphosphate hy 
 149::180  0.00075 37.5% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 149::176  0.00086 42.9% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 145::220  0.00089 32.9% 0040121 00401212 2/2   p containing nucleoside triphosphate hy 
 151::210  0.00097 28.8% 0046551 00465512 2/2   p containing nucleoside triphosphate hy 
 141::217    0.001 28.6% 0050482 00504822 2/2   p containing nucleoside triphosphate hy 
 137::220   0.0013 27.4% 0037412 00374122 2/2   p containing nucleoside triphosphate hy 
 148::220   0.0019 30.5% 0048426 00484262 2/2   p containing nucleoside triphosphate hy 
  59::119   0.0035 24.6% 0040121 00401211 1/2   p containing nucleoside triphosphate hy 
 144::210   0.0086 28.8% 0044990 00449902 2/2   p containing nucleoside triphosphate hy 
  59::132    0.074 23.3% 0044740 00447401 1/2   p containing nucleoside triphosphate hy 
  59::150     0.18 23.3% 0036958 00369581 1/2   p containing nucleoside triphosphate hy 
  59::133     0.18 26.0% 0044990 00449901 1/2   p containing nucleoside triphosphate hy 
  59::134     0.23 21.1% 0039672 00396721 1/2   p containing nucleoside triphosphate hy 
  59::150     0.26 22.2% 0037248 00372481 1/2   p containing nucleoside triphosphate hy 
  53::121     0.36 23.9% 0040984 00409841 1/2   p containing nucleoside triphosphate hy 
  72::130     0.61 27.1% 0052691 00526911 1/2   p containing nucleoside triphosphate hy 
  59::147     0.77 21.3% 0048426 00484261 1/2   p containing nucleoside triphosphate hy 
  52::134     0.91 23.8% 0046551 00465511 1/2   p containing nucleoside triphosphate hy 
   5::119        1 20.6% 0043218 00432181 1/2   p containing nucleoside triphosphate hy 
  59::147      1.1 22.1% 0046936 00469361 1/2   p containing nucleoside triphosphate hy 
  59::119      1.1 25.4% 0051769 00517691 1/2   p containing nucleoside triphosphate hy 
  75::146      1.1 26.8% 0051376 00513761 1/2   p containing nucleoside triphosphate hy 
  59::138        2 19.2% 0036239 00362391 1/2   p containing nucleoside triphosphate hy 
  70::148      2.3 24.3% 0048819 00488191 1/2   p containing nucleoside triphosphate hy 
  58::137      3.1 19.0% 0047127 00471271 1/2   p containing nucleoside triphosphate hy 
  52::135        4 20.0% 0048180 00481801 1/2   p containing nucleoside triphosphate hy 
  59::136      5.8 22.1% 0037412 00374121 1/2   p containing nucleoside triphosphate hy 
  51::132      7.9 22.8% 0041412 00414121 1/2   p containing nucleoside triphosphate hy 
  58::119       20 22.6% 0050482 00504821 1/2   p containing nucleoside triphosphate hy 
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
00495771   1/1  --------------------------------------------------------------nellrpiv
00497591   1/1  --------------------------------------------------------------reelrlva
00495761   1/1  lleGlvikalggfylVllenselgklilcrlrgklrknkikplvGDrVlvepldlgkgvIve--------
00424711   1/1  ---------------------------------------------------------hskkaldelelvl
00441791   1/1  ieleGlvvellgnfyfvvllengllllchlrgklrknkirilvGDrVelspydlgkgrIver--------
00440861   1/1  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00369582   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00362392   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372482   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00469362   2/2  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00526912   2/2  ----------------------------------------------------------------------
00396722   2/2  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00374122   2/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------hedflkellral
00449902   2/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------qeefrsllelyl
00369581   1/2  ----------------------------------------------------------hedflkevlrgl
00449901   1/2  ----------------------------------------------------------qeefrslrelyy
00396721   1/2  ----------------------------------------------------------hedfrkevirgl
00372481   1/2  ----------------------------------------------------------hedfskevlrgl
00409841   1/2  ----------------------------------------------------Glidfaseptnlldleii
00526911   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------qedfrslveryl
00465511   1/2  ---------------------------------------------------dgapellqedfralvlryl
00432181   1/2  ----LlnallglkvaivsdypgttrdptlgvveldgrklvliDtpGleefa......sggekqrvalala
00469361   1/2  ----------------------------------------------------------hedfrsltlryl
00517691   1/2  ----------------------------------------------------------hedfvkevlral
00513761   1/2  ----------------------------------------------------------------------
00362391   1/2  ----------------------------------------------------------hvdfvkevlrgl
00488191   1/2  ---------------------------------------------------------------------l
00471271   1/2  ---------------------------------------------------------lqeefralvlryl
00481801   1/2  ---------------------------------------------------dgaseglqedfrslllryl
00374121   1/2  ----------------------------------------------------------qeefrsltlryl
00414121   1/2  --------------------------------------------------sgGqkqrlalaralladpdl
00504821   1/2  ---------------------------------------------------------lqedfrkltlryl


                         -         -         *         -         -         -         -:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
00495771   1/1  anvdlvlivvdardplfslnlllrylvlaeaagippvlvlnKiDlleeeedlelleellkelesigvdvv
00497591   1/1  anvdvvllvvdardplfslnlllrylvlaeaggipvilvlnKiDll.ddeeleellelldelslgldvva
00495761   1/1  ----------------------------------------------------------------------
00424711   1/1  dnadvilevvdardp...llsldvrlaelle.gkprllvlnKaDlldaealalllealslglgnvafksa
00441791   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------ldllglelllsl
00369582   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00362392   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372482   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00379601   1/1  ---------------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpgg
00469362   2/2  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00467111   1/1  --lgepiqlidedg..glldlldelleilseid.....................................
00504231   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00488521   1/1  ------------------------------------lllllalelllevenl...ristgikeldklls.
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00414001   1/1  ---------------------------------------------------------------------r
00470231   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00431331   1/1  -------------------------------------------------------ledlldlllllllll
00477011   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00527261   1/1  ---------------------------------------------------------------------n
00470731   1/1  ----------------------------------------------------------------------
00526912   2/2  ----------------------------------------------------------------------
00396722   2/2  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00374122   2/2  ------------------------------------------------------------------gell
00484262   2/2  ----------------------------------------------------------------------
00401211   1/2  aladgallvvdadegeflpqtlevlllllelgvkpiilvlNKiDlvdae---------------------
00449902   2/2  ----------------------------------------------------------------------
00447401   1/2  rgadgvllVvdatdpesfenlkkwleellellgllllagvpiilvgnKiDlld.revleela--------
00369581   1/2  avadgallVvdategvlp..qtrevlllakllgvpniivvlNKiDlvdaeerleevleelrellkllgll
00449901   1/2  rgadavllvvdat..dpesfenlkkwleellelldllllagvpiilvgnKiDllerevlleel-------
00396721   1/2  rvadgailVvdasdgesfagievepqtrellllarllgvphiivviNKiDlldadeleevleei------
00372481   1/2  avadgallVvdaadgvsp..qteevlllarllgvpkiivvlNKiDlldadelleevkeelrellkllgll
00409841   1/2  eallraleeadvvllvvdadrglleqdle..llelllelgkpvilvlNKiD-------------------
00526911   1/2  -gadgillVvdatdpesgfeeltkellellrelgllagvpliilvlNKiDlldareveel----------
00484261   1/2  rgfleeadgvllVvdatedregfeeqtkellellrllglllllgvpiilvlNKiDlldareveevleelk
00465511   1/2  rgadgvllvvdatd..lleqllelleellel.gvpiilvlNKiDlldarevsleeleelakklg------
00432181   1/2  llreadvlllvvdadeptsfldle..llellrelllagkpvilvlnKiD---------------------
00469361   1/2  rgadgallVvdatdgvsfqtl..ellelllelgvpiilvlNKiDlvdadel.eeleellkklglplelvp
00517691   1/2  rladgallvvdadegvsl..pqtrevlllllllgvpniivvlNKiDlvd---------------------
00513761   1/2  ----aadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseeg.lelvlelleelle
00362391   1/2  rvadgailVvdavegvmp..qtrehlllarllgvpkiivviNKiDlvdaderlelvveellellkklg--
00488191   1/2  rgadvvllvvdatd.glleqtlelleellel.gvpiilvlNKiDlldaeeleevveeleelllalglgip
00471271   1/2  rlrgadavllVvdatdpglfeqd.lellkellelfgelagvpiilvlNKiDlldaeeveleeeiael---
00481801   1/2  rgadvvllvvdatd.glleqdlellellrel.gvpiilvlNKiDlld..vlleeleellkelglp-----
00374121   1/2  rgadgvllVvdasdgdsfeevlelleellellllanvpiilvlNKiDlldar.eleellellelll----
00414121   1/2  gellllDeptlvlDaasg...edlldllkelaeqlgltvlivlnKiDllselthdlellrel--------
00504821   1/2  rgadvvllvvdatdglfeqtlellellrellpgvpiilvlNKiDllddr---------------------


                         +         -         -         -         -         *         -:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
00495771   1/1  lvsakkgalldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle
00497591   1/1  vsaktglgidellellkglkvvlvGrsgvGKStLlnallgekvakvsdisatlgrgpgttrdiilikldr
00495761   1/1  ----------------------------------------------------------------------
00424711   1/1  lgglglealldlllellkellellrlslllkkglkvalvGlpnvGKSTLlnaLlgakvaivsdip.....
00441791   1/1  ----------------------------------------------------------------------
00440861   1/1  --MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsG
00471272   2/2  -------prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallg......gdf
00381441   1/1  --------GeliaivGpsGsGKsTLlklLagllppdsgsi......gslttrlprlgevdgvdltfls--
00523461   1/1  --------akv.alvGlpnvGKStLlnall.......gdk.aivsdipgitrdiqtgtlekltliDtpGl
00494851   1/1  ldrllllkkkllkvalvGlpgvGKStLlnall.......gakflakvsptpgttidiklgvlgvkltliD
00369582   2/2  ----------kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllklerergitidiglv
00432182   2/2  --slelkkglkvalvGrpgvGKStLlnallglkvaivsdyp...gttrdptlgvveldgrklvliDtpGl
00493431   1/1  -------kGelivllGpsGaGKsTllkllagllgptsgvis-----------------------------
00409842   2/2  -lslelkkglkvalvGrpgvGKSTLlnaLl...gadlaivsdipgttrdpilgvvlldgrdllllDtPGl
00362392   2/2  ------krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslkeerergiTidigavtletd
00488192   2/2  --------fllsllrrlslllkrllkvalvGlpgvGKStLlnall.......gakflakvsptpgttrdi
00513762   2/2  ---------kiiaivGkgGsGKTTllnkl-----------------------------------------
00405881   1/1  --------gervglvGrpgaGKSTLlnal...tglk.aivsgypgttldpnlgvvelddgrqlvlvDtpG
00372482   2/2  ----------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleeerergit
00414122   2/2  ------kpgevvllvGpsGaGKTTLlrallglleglkvavi-----------------------------
00379601   1/1  pvrvridgvlelllvvldllsldleellalasriavlagrd-----------------------------
00469362   2/2  ----------MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttrldsleeerergiti
00475381   1/1  --------mkgeiialtGpsGsGKsTlarlLagllkptsgiv----------------------------
00511561   1/1  ---------lkvalvGlpnvGKStllnall...gadfaiventpgttidiklvvvelkgvklvliDtpGl
00485931   1/1  ---LsvpkgevvalvGpnGaGKTTllallagllaptggkv------------------------------
00512891   1/1  ---------evilltGppGvGKTTlakalagelgakfgsvs-----------------------------
00467111   1/1  ......qpvlvvaivGrpnvGKStLlNaLl................gekvgfaivsgvpgtTrdiwmwiv
00504231   1/1  ---------mkkklrnvaivGhvnvGKsTLlnrLlgelglidkdvaiverergiTidialvilelkgrkl
00484101   1/1  -------kgpvigivGpsGsGKTTllraLagllkprggrv------------------------------
00488521   1/1  ...gglppgeitlivGpsGsGKTtLllqlavngllppdsG------------------------------
00480471   1/1  --sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpe------------------------------
00477971   1/1  ------hkgelvvlvGPsGaGKsTLlnaLlgllp.tsgvisv.....sgttrpprpgevdg---------
00481802   2/2  --------aki.alvGlpnvGKStllnallga...dfaivedtpgttidinlgvveldgvkltliDtpGl
00475471   1/1  -------mglkvalvGlPNVGKSTLlNaL...tgak.aivanypgtTrdpnlgvvelpdgrldllaelvk
00533501   1/1  --------rgeiialtGpsGsGKsTlaklLaellphldtgd-----------------------------
00374071   1/1  ----------lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslllaavld
00499191   1/1  --------kgkiigitGpsGsGKsTlaklLaellgatvgd------------------------------
00447402   2/2  -------kelkivlvGdsgvGKttLlnrllgnk.fivsyip.......titvdiltkeveidgkrvklll
00414001   1/1  rlllelkmllrvgivGlpNvGKSTLfnaLt...gakvaivanypftTldpnlgvvelpderldllaglak
00470231   1/1  --------elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl.........kivsdpgtT
00485451   1/1  --------skiygdealkdvsleikkllnlsgkpgeiigi------------------------------
00492921   1/1  ----------ekkirnvaivGhvnaGKtTLlnrLlgek...ldilseerergitidsaattleldgrdll
00477721   1/1  --------kpklilltGppGsGKttlaraLaeelgl----------------------------------
00431331   1/1  llslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgkgslllalvldsldeEre
00477011   1/1  ----------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrr
00493171   1/1  --------mgklivllGpsGaGKsTlaklLaeklglivlsvg----------------------------
00527261   1/1  pfilgpkvdledfigreeelkeleeal.pkivlltGprGsG-----------------------------
00470731   1/1  -------arpltfddvvgqdeakeeleellagllgikkpkv-----------------------------
00526912   2/2  ---------rkvalvGlpnvGKStLlnrllgak..........vse.pgtTiginfgtvelkdgklvklt
00396722   2/2  ------------krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfllllvlds
00500611   1/1  --pgllsllelllelenltklptgipaLddvlgggipkGe------------------------------
00498681   1/1  ---------llkvalvGlpnvGKStllnallg....dkfivsnipgitidpnvgtveldgkvkltliDtp
00517692   2/2  -------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfllalvlds
00464411   1/1  --------vkkgeiivllGpsGsGKsTlaklLagllgptg------------------------------
00515351   1/1  --------mngklivltGppGsGKtTlaraLaerlg----------------------------------
00401212   2/2  ----elkrglnvgivGhvgaGKSTLlnaLl...gllldtlkgelergitikigaasllldklaivsdtpg
00465512   2/2  ----------ekkrllkvalvGlpnvGKStllnallgakfai.......vedepgitidinlg.veldgk
00504822   2/2  eklrllk....valvGlpnvGKStllnallgakfai...vedepgitidinlgtveldgkklvliDtpGl
00374122   2/2  rlslllkkllkvvlvGlpnvGKstLlnrll..........ggdf.depgpTiginfgtveldgvkltliD
00484262   2/2  -------kkllkialvGhpnvGKStLlnrltgekv.............pgttgaidii.gtveldgvkln
00401211   1/2  ----------------------------------------------------------------------
00449902   2/2  ---kkkkkllkillvGdsgvGKStLlnrllggk.fivsyip.......titvdiltktveldgkkvkltl
00447401   1/2  ----------------------------------------------------------------------
00369581   1/2  gelvpvvpiS------------------------------------------------------------
00449901   1/2  ----------------------------------------------------------------------
00396721   1/2  ----------------------------------------------------------------------
00372481   1/2  ledvpvvpiS------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00526911   1/2  ----------------------------------------------------------------------
00484261   1/2  eelkala---------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00469361   1/2  llldlll---------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00513761   1/2  llpill----------------------------------------------------------------
00362391   1/2  ----------------------------------------------------------------------
00488191   1/2  vvevsakt--------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00374121   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
00495771   1/1  glvliDtpGfrdtileniekeeleatfeeireadlvllvidaihllepdlavlealeeggipvilvlnkl
00497591   1/1  gllliDtPGirefglldeeaveltllylegadll..llvvdathgfepdcavlealeeggipiilvlnki
00495761   1/1  ----------------------------------------------------------------------
00424711   1/1  ..gtTrdivlgvl.gkklvliDtPGllefaseleglgkklverflryleeadlvllVvdasdgls-----
00441791   1/1  ----------------------------------------------------------------------
00440861   1/1  KStLlnaLlgllkpdegvilvg...gkgvTrdivlytledgvkltliDtpGlgdtklsdee.klilkyle
00471272   2/2  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00494851   1/1  tpGlgdldviielaerlrdlvreylra-------------------------------------------
00369582   2/2  sleldglkit------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00409842   2/2  idfase----------------------------------------------------------------
00362392   2/2  grlitliDtP------------------------------------------------------------
00488192   2/2  ktveldgkltliDtPGlgdllviiela-------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372482   2/2  idsgavslet------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00469362   2/2  dsglvkfeln------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00467111   1/1  vlieldgrp-------------------------------------------------------------
00504231   1/1  nliDtPGhed------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00374071   1/1  sleeerergi------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00492921   1/1  lllllgklll------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00431331   1/1  rgiTidiaav------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00526912   2/2  liDtpGqedf------------------------------------------------------------
00396722   2/2  ldeerergit------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00517692   2/2  lplerergit------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00401212   2/2  ttldpilgvl------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00504822   2/2  idgasel---------------------------------------------------------------
00374122   2/2  tpGqeefrsl------------------------------------------------------------
00484262   2/2  liDtpGqedf------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00449902   2/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00369581   1/2  ----------------------------------------------------------------------
00449901   1/2  ----------------------------------------------------------------------
00396721   1/2  ----------------------------------------------------------------------
00372481   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00526911   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00469361   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00362391   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00374121   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ETYKKVSKKIPK----------------------------------------------------------
00495771   1/1  dll-------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00495761   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00441791   1/1  ----------------------------------------------------------------------
00440861   1/1  eadlvllviddgl---------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00369582   2/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00362392   2/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372482   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00469362   2/2  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00526912   2/2  ----------------------------------------------------------------------
00396722   2/2  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00374122   2/2  ----------------------------------------------------------------------
00484262   2/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00449902   2/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00369581   1/2  ----------------------------------------------------------------------
00449901   1/2  ----------------------------------------------------------------------
00396721   1/2  ----------------------------------------------------------------------
00372481   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00526911   1/2  ----------------------------------------------------------------------
00484261   1/2  ----------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00469361   1/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00362391   1/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00374121   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------