[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56127.1


[Show Plain Result]

## Summary of Sequence Search
   1::555
   1::201  3.1e-46 39.4% 0044458 00444581 1/1   bacter dihydroxyacetone kinase extra AT 
   1::555


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
00444581   1/1  llllelleellelsllkldlelllelllaaaevlienedylnelD.fpvGDGDtGinmargaeavleald


                         -         -         *         -         -         -         -:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
00444581   1/1  dlkleladlaellkaialallsgagGtsGvlygilflglakalkgk.....edlaeallaaleavykrgk


                         +         -         -         -         -         *         -:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASED
00444581   1/1  akpgdkTlldvlvpaveal.......ldllelleaaveaaeegaesTakdllaklGRAsyl---------


                         -         -         -         +         -         -         -:280
query           FVATPANMSEMINVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVV
00444581   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NDDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEYALIAVVAGKG
00444581   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
00444581   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTTAVRDTTIDGLEIHENDNLGMVDGKILVSNPDM
00444581   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           HQTLTETLKHMLDEDSEIVTFYVGEDGSEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE-----
00444581   1/1  ----------------------------------------------------------------------