[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56181.1


[Show Plain Result]

## Summary of Sequence Search
   1::358
 127::329  1.5e-75 46.8% 0046003 00460031 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 127::329  5.4e-75 44.3% 0040869 00408691 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::329  1.8e-67 46.0% 0052979 00529791 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 127::337  2.4e-67 55.2% 0035953 00359531 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 126::329    3e-63 45.6% 0041597 00415971 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 127::329    1e-61 47.9% 0053020 00530201 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::154  4.9e-52 50.7% 0052818 00528181 1/1   )-binding Rossmann-fold domains         
 128::334  1.9e-50 42.6% 0035946 00359461 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::156  1.3e-49 46.1% 0052978 00529781 1/1   )-binding Rossmann-fold domains         
 128::334  7.1e-46 37.2% 0038023 00380231 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::334  7.9e-44 37.9% 0038051 00380511 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::142  1.4e-41 43.6% 0040868 00408681 1/1   )-binding Rossmann-fold domains         
   2::140    3e-41 47.5% 0035680 00356801 1/1   )-binding Rossmann-fold domains         
   2::140  2.8e-39 41.7% 0041596 00415961 1/1   )-binding Rossmann-fold domains         
 128::334  7.9e-39 33.3% 0036580 00365801 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::334  2.6e-38 35.2% 0045517 00455171 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::144  3.2e-36 38.0% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
 127::337  3.1e-35 31.9% 0052355 00523551 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::160    4e-35 34.2% 0052326 00523261 1/1   )-binding Rossmann-fold domains         
 127::333  1.5e-31 22.2% 0041771 00417711 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::334  1.6e-30 25.5% 0039315 00393151 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::334  1.7e-27 19.8% 0047176 00471761 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::159  1.2e-25 27.6% 0051147 00511471 1/1   )-binding Rossmann-fold domains         
 128::325    6e-24 28.1% 0050229 00502291 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::167  3.4e-22 25.8% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 128::321  7.3e-21 24.8% 0051148 00511481 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::334  3.1e-20 18.8% 0051902 00519021 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 128::325  9.9e-19 25.2% 0052327 00523271 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::304  4.2e-15 20.9% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   3::122  1.9e-14 25.0% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
 235::309  4.1e-12 30.7% 0035390 00353902 2/2   raldehyde-3-phosphate dehydrogenase-lik 
   3::149  1.3e-11 22.2% 0038050 00380501 1/1   )-binding Rossmann-fold domains         
   3::158  1.7e-11 24.8% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
   2::145  4.7e-09 19.1% 0039650 00396501 1/1   )-binding Rossmann-fold domains         
 128::325  1.9e-08 16.7% 0047635 00476351 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::102  2.2e-08 22.7% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   3::116  6.7e-08 21.8% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
   1::173  7.8e-08 25.2% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::105    3e-07 27.9% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::121  6.1e-07 22.7% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::153  8.3e-07 20.1% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   1::96   1.7e-06 28.7% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   1::221  1.9e-06 21.7% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   1::98   2.4e-06 27.6% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   1::73   3.6e-06 28.2% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   1::89     6e-06 32.6% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   3::163  7.8e-06 26.3% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::151  2.5e-05 18.2% 0052183 00521831 1/1   )-binding Rossmann-fold domains         
   2::92   3.2e-05 26.4% 0039919 00399191 1/1   )-binding Rossmann-fold domains         
   2::147    5e-05 21.3% 0045894 00458941 1/1   )-binding Rossmann-fold domains         
   1::73   5.7e-05 34.4% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   2::126  7.9e-05 23.7% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   1::158   0.0001 17.7% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   4::75    0.0001 30.6% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   1::93   0.00018 24.4% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   1::96    0.0006 35.2% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
  45::148  0.00072 27.7% 0049820 00498201 1/1   )-binding Rossmann-fold domains         
   1::73   0.00077 32.4% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
 128::161   0.0073 20.6% 0035390 00353901 1/2   raldehyde-3-phosphate dehydrogenase-lik 
   1::358


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALF
00460031   1/1  ----------------------------------------------------------------------
00408691   1/1  ----------------------------------------------------------------------
00529791   1/1  ----------------------------------------------------------------------
00359531   1/1  ----------------------------------------------------------------------
00415971   1/1  ----------------------------------------------------------------------
00530201   1/1  ----------------------------------------------------------------------
00528181   1/1  -klkvavvGAtGavGeelvelLeehpdfevtallllasersaGkklsflgpslvglkdleveeldpaeev
00359461   1/1  ----------------------------------------------------------------------
00529781   1/1  --glkvaivGatGlvGqellelLeehpfpeltllllasrssagkylefvgkdlkvleldefdfsdvdivf
00380231   1/1  ----------------------------------------------------------------------
00380511   1/1  ----------------------------------------------------------------------
00408681   1/1  --mkvaivGatGmvGsvllelLleergfevvalvrlsssrsagkalvfkgvellvvdlldlealkgvDvv
00356801   1/1  -mkkvaivGAtGmvGsvllkllleerdfpvillvllassrsagkavsfkgvtlvvgdlldlealkgvdiv
00415961   1/1  -klkvgivGatGmvGsvllnllleendFevieivflassrsagkkllflgkellvlldaldidalsgvDi
00365801   1/1  ----------------------------------------------------------------------
00455171   1/1  ----------------------------------------------------------------------
00530191   1/1  kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasagkgvevvlgdltdldllaaalagvdvvfl
00523551   1/1  ----------------------------------------------------------------------
00523261   1/1  --kalkkikvailGAtGyvGqellrlLlnh..pevelvalassssagkklsdllplllglkdlvvlelda
00417711   1/1  ----------------------------------------------------------------------
00393151   1/1  ----------------------------------------------------------------------
00471761   1/1  ----------------------------------------------------------------------
00511471   1/1  mpikvaiiGasGytGgellrlll..nhpdlellllasresagkkleevypdlrglldlvleladleelke
00502291   1/1  ----------------------------------------------------------------------
00502281   1/1  -mmkvlitGAtGfiGselvrlLle..hgdhevtaldrrtsagkllnepgvevvegdltdpddlekalkgv
00511481   1/1  ----------------------------------------------------------------------
00519021   1/1  ----------------------------------------------------------------------
00523271   1/1  ----------------------------------------------------------------------
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlerga.vskVtalvRrpekleelaaegvevvvgDlt
00456451   1/1  --mienlllllelllelellkslkkpmkvlvtGAaGfiGshlallLasgglagldqvvelvlldiveslg
00353902   2/2  ----------------------------------------------------------------------
00380501   1/1  --kikvgiiGa.GriGrellrallaspdvelvavadrddaaalaaalkydsthgkfdgtvkaedgklvvn
00422071   1/1  --mkVgivGAtGrvGrllvrllla..hpgvevvavvsraeaaellkllgadvvvdatppdvlaelaeall
00396501   1/1  -mvkvginG.fGriGrlvlraalesgekvevvaindfidlnylvymlkydsthgkfkgtvkaedgklvin
00476351   1/1  ----------------------------------------------------------------------
00481861   1/1  --kkvlvtGAsGgiGsalalllaarga...evvlldrspeklegvaldlsdlgvevvvadltdpeslaea
00509141   1/1  --nkkkrvaiiGa.GriGsalaralleap.gfevvgvfdvdpekvgraie..glpvlgvddleelleggv
00367851   1/1  kgkkvlviGa.GgiGralaraLae..aGa.evt..vadrslekaealaaelggveavelDvtdeasldaa
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellarga.vskvialvRrpekleelaaegvevvvgDltdp
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsd..galavlldl
00484541   1/1  mmkklkvaiiGa.GniGlalarallalag....gaevvavadrdpekaglalakelgatttvnavddlee
00430421   1/1  MkgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglg..vevvegDltdpes
00516961   1/1  kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpskllpgvevvvgDltdp..laealagvdvvih
00430411   1/1  MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaapgvevvegDltdpesl
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlvevvlldr
00532871   1/1  lsgktvlVtGAtGgiGsalvrrLleag...dvaevvalvrspekleelgggvevvvgDltdpdslaaala
00387841   1/1  --kkvlvtGAsGgiGsalalllake..gaevvlvdrdeekalealagelldlgggalvlvadvtdleave
00521831   1/1  m..KilviGaaGyvGsslalllakkgllgdelvlvDi.eekleglaldlsdiaefllldlvittdlyeal
00399191   1/1  -pikvallGltGtVGqgvvklLeenpelfevvalragrnvalkvelvleykdaavavrdedkprelkdll
00458941   1/1  -pirvaviGa.GriGrrvaealael..pdvelvavvdrspdaaalaallkyistlgrlgglvkaeelgvp
00464721   1/1  MgktvlvtGatGfiGsalaraLlar..GaveVvaldrspe..........Dltdpeslaaalagvrvdvv
00425341   1/1  -lsmvlkgkkvaviGa.GliGlalalllallglgeVvlyDinpekleglaadladilelllvkgriratt
00475161   1/1  hgkkvgiiGl.GniGkavakllk..gfgmevlaydrrpke...........gavyvsldellaesDvvvl
00371281   1/1  ---kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgaklgpgvefvegDltdpesleaaleevekfg
00471781   1/1  mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaallglgvevvvgDltdpaslaaalagvda
00511831   1/1  llllmmmslegktvLVTGAtGfiGsalvrrLlerG.....yeVvaldrspekleelaallealggdpgve
00498201   1/1  --------------------------------------------ikfeddalvingklidvlserdpedi
00400431   1/1  MgkkvLvTGgtGfiGsalvraLler.....GaevvvldrdpegaaellallealggprvefvagDltdpe
00353901   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
00460031   1/1  --------------------------------------------------------NCttilmvvaLkpL
00408691   1/1  --------------------------------------------------------NCttilllvalkpL
00529791   1/1  ---------------------------------------------------------CttillllaLkpL
00359531   1/1  --------------------------------------------------------nCstiqlvvaLkPl
00415971   1/1  -------------------------------------------------------PnCttillvvalkpL
00530201   1/1  --------------------------------------------------------ncttiqlvlaLkpL
00528181   1/1  fsgvdlvffaagaevsrelapralkagavvidnssafrlddeelyekyygvslelpellpdvPlvvPevn
00359461   1/1  ---------------------------------------------------------Cstiqlvvalkpl
00529781   1/1  falgsevarelapkaaeaGvvvidnssafrldpdvPlvvpevnpehldllgfivanPnctttalalalap
00380231   1/1  ---------------------------------------------------------Cstaqlvvalkpl
00380511   1/1  ---------------------------------------------------------Cttiqlvvalkpl
00408681   1/1  ifaaggdvtlklapalaeagvkrvvidsssalrmdddvplvvpevnreaikdalakgggiianpncttil
00356801   1/1  ifaaggdvslelapalreagvrlvvidnssalrmdpdvplvvpevnrevikdalalgvkiianPncttil
00415961   1/1  iilclGgdvskevapklaeagwkgvvidaasalrmeddvplvlpevnlevikdllarglkiianpnCtts
00365801   1/1  ---------------------------------------------------------Cstiilvpalkpl
00455171   1/1  ---------------------------------------------------------Cttillvpalkpl
00530191   1/1  aagagatlalaeaaaaagvkvidlssafrad.dvpyglpkvnaealllasglni.iarpgcyttplvlal
00523551   1/1  --------------------------------------------------------sCnTtglaralkpL
00523261   1/1  ealsdvDvvFlalphgvalelvk.llkaglkviDlsadfRlddavpyvvpyvnphhldlllkkavyglpe
00417711   1/1  --------------------------------------------------------sCTTnclapllkvL
00393151   1/1  ---------------------------------------------------------CTTnclapllkvl
00471761   1/1  ---------------------------------------------------------CTTnclapvlkvL
00511471   1/1  aDivflalphgasaelvpllle.glkviDlsgdyrledfelyealygveklvpeldgewvyGlPElnree
00502291   1/1  ---------------------------------------------------------CyptaallalaPL
00502281   1/1  Dvvihaagtsrvdeslkdal..gtnvigtssalrllnlleaakeagvkrfvhvstagvygllegvpelle
00511481   1/1  ---------------------------------------------------------CyataailalaPl
00519021   1/1  ---------------------------------------------------------CTTnclapvlkvl
00523271   1/1  ---------------------------------------------------------CyptaailalaPl
00519911   1/1  dpeslaaalkgvdvvinaagitrvgedleefldvnvdgtlnlldaakkagvkrfvlvSslgalgp.....
00456451   1/1  klegvaldlsdaafpllgdvtvgtdlyeafkgadvvvhlAgvprkpgmdrld------------------
00353902   2/2  ----------------------------------------------------------------------
00380501   1/1  gkligvlvvtdpaelllgdegvDvvvdatppgahaenalaaleaGvkhvivekPla..advvellvglnr
00422071   1/1  kagvdaVilsaGfrlsdlllvellydaaggvkvv.............................iaanasc
00396501   1/1  gkaikvvqerdPanikwgelgadyvvectgvfttlekagahlkgGakvViisapsa..gdaptfvmgvnh
00476351   1/1  ---------------------------------------------------------CTTnclapvlkvl
00481861   1/1  lkgadvvviaagiprkpgedrldlldvnvlgv--------------------------------------
00509141   1/1  dvvilavPaeaaqevadelleagvkvillpplarllvgaavvvrev------------------------
00367851   1/1  lgdaDvvinaapvglhaeiveaaleagkhvvde......npla.aetralleaakea..gvgrivnvssa
00527221   1/1  eslaealkgvdvvinaagttrfgedleeflavnvd-----------------------------------
00354771   1/1  tdtddlaealkgadvvvhlagvprkpgedrddllavnvlgtralleaarka-------------------
00484541   1/1  lladpgvDvvieatpagahaevalaaleagkhvvvekptaltveeavvpl....velvelaeekgvvlgv
00430421   1/1  laealkgvDvVihlaglevidvnvlg--------------------------------------------
00516961   1/1  lagvvrfsagdpeaflavnvdgtlnlleaaraagvkrfvlvSslgaygd.....................
00430411   1/1  aealkgvdvVihlagdvnvlgtlnllea------------------------------------------
00360071   1/1  les-------------------------------------------------------------------
00532871   1/1  gvdavvhlagivgvgalll---------------------------------------------------
00387841   1/1  dlvealggadvvvnnagvp.......................rkpgeerldllevnvlg...........
00521831   1/1  kdadiviitagvprkpgmsrldlle...........inakivkdiakaikkyspkaivlvvtnPvdtltl
00399191   1/1  veegveledllltddalelved------------------------------------------------
00458941   1/1  vyddleelledvDvvviatptdthaevakaaleaGvkhVlvekPlaeeaglklmvghnrrfdpa..lkli
00464721   1/1  ihl-------------------------------------------------------------------
00425341   1/1  dlyealkgaDvviiavgvprkpgliaellkrgdllvtnasilv......diieala--------------
00475161   1/1  capleaineealaalkkgailintsrgalvdeeallelleagkiagagldvlsgeplgld..........
00371281   1/1  gvdvv-----------------------------------------------------------------
00471781   1/1  Vihlagpadpldllevnvdgtrn-----------------------------------------------
00511831   1/1  lvvgDltdpesleaalegvdvvihlA--------------------------------------------
00498201   1/1  dwgklgvdlvleaTGkfttlenlllhlkggakkv...ivsapsadiatvvlgvndeeldakldiisvasc
00400431   1/1  ale-------------------------------------------------------------------
00353901   1/2  ---------------------------------------------------------CtTngLapllkvl


                         +         -         -         -         -         *         -:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
00460031   1/1  heafglervvvsTyqAvSGaGakgveelleqlgallngveseladpasaildidrkvlellrleeleldv
00408691   1/1  hdafgiervlvsTyqAvsGaGakgveeLlsqlgallngvelelddllldildidlrvaraaalsiiptst
00529791   1/1  lkafliervvvstyqavSGaGakgveellsqtaellngldvkvhrllreleleldvfpvplafNviPlid
00359531   1/1  hdafgikrvvvstyqavsGag..................................kfpgpiafnllpnii
00415971   1/1  hdafgiervlvsTyqAvsGaGakgveelleqlgallngvelelddlasaildidqlvldllhsdllrarv
00530201   1/1  hdafgiervvvstyqavSgaGaegvdeLagqtaellngk...........plepevfprplafnviPlid
00528181   1/1  pehl.kkggivanP--------------------------------------------------------
00359461   1/1  ldafglervlvstyqavsgaGk........................lvdgpskllvkgrgiafniiPaid
00529781   1/1  Llelfgieevlvttlq------------------------------------------------------
00380231   1/1  hdafglkevlvttyqavsgagk.......................tldglsgkllvfgrgiaqniiPait
00380511   1/1  heefgleevlvttyqavsgagk......................lldgls..kllvfgrpiaqnviPaid
00408681   1/1  ll--------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00365801   1/1  hdkfglkevlvttyqavsgagk.......................tldglsgkllvygrgiaqnviPait
00455171   1/1  hdafglkrvlvttyqavsgaGk.......................tldglsgklgvfgrgiafnviPhit
00530191   1/1  apll------------------------------------------------------------------
00523551   1/1  hdafgiervllttrqa....................................dpkrfgrgianniiPsit
00523261   1/1  lnrekikkaklvanPGCyat--------------------------------------------------
00417711   1/1  hdafgieeglmttvhavtgdqk......................lldgph..kdlrrgraaalniiPtst
00393151   1/1  hdnfgieeglvttvhavtgsqk..............................tldgphgkdlrrgraaal
00471761   1/1  hdafgiekglmttvhaytgdq......................llldgph..kdlrrgraaalniiPtst
00511471   1/1  iknaklianPgcyatkGai---------------------------------------------------
00502291   1/1  vkaglldldrivvdavsGvSGAGkkaieell.......................faevlenliaYgllgh
00502281   1/1  dallilnpnlygvskllaerpli....-------------------------------------------
00511481   1/1  lkaglldldriivdavsGvSGAGrklieel................................lfaevlen
00519021   1/1  hdafgieeglmttvhaytgdqk.....lldgphgkakdlrrgraaalniiPtst................
00523271   1/1  vkaglldldriivdavsGvSGAGrklieellf.......................sevlenliaYgllgh
00519911   1/1  ......................................................................
00456451   1/1  ----------------------------------------------------------------------
00353902   2/2  ----------------------------------------------------------------------
00380501   1/1  eadkslgvv-------------------------------------------------------------
00422071   1/1  gvnllvplaklladafgi----------------------------------------------------
00396501   1/1  ekyds-----------------------------------------------------------------
00476351   1/1  ddafgieeglmttvhaytndqklldgph.kdlrrgra.......................aalniipt..
00481861   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00367851   1/1  agy...........adgrglpayqaakaaleal-------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00484541   1/1  gfgvrflppvvka---------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00516961   1/1  ..plspyarsKaaaeallralglprvtilrpglvygprdgfllallll................llllgd
00430411   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00387841   1/1  .......tknlaealkkagpgri-----------------------------------------------
00521831   1/1  ialklsgklgl-----------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00458941   1/1  elviisr---------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475161   1/1  ....plleldnviltphi----------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00498201   1/1  tttalapl--------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00353901   1/2  ndkfgieevlvttvrratdpq-------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VFTDNDYTYEEMKMTKETKKIMEDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
00460031   1/1  fpvplafnviPlidvfldngytkEElklvnEtrKilglddelkvsatcvRvPvlrghseavtvelekdvs
00408691   1/1  faaplafnviPlidvfldngytkeelkmvaEtrKilglldpdlkvsatcvRvPvlrghsealtvelekdv
00529791   1/1  vfldngytkeElklvnEtrkilgdpdlkvsatcvrvPvlrghseavyvelekdvsveevrellaeapgvv
00359531   1/1  pfidg...........etkkilgvldlkvsatavrVPvllgHsesvlvelekkvsveeilevlkkapgvv
00415971   1/1  fpvpiafnliPlidgllkdngytkEelkmvaEtrKilglpdldlkvdatcvRvPvlrghsealtvelkkd
00530201   1/1  vflengytkeElklvaetrkilgdldlkvsatcvrvPvfrghsesvtvelekdvdveevrelladapgvv
00528181   1/1  ----------------------------------------------------------------------
00359461   1/1  ............kaakevgkilpelnlkvtgtavrVPvlnvhvvdltvelekpasveeikevlkqasevv
00529781   1/1  ----------------------------------------------------------------------
00380231   1/1  ............gaakevgkvlpelnlkltgtavrVPvlnvhvvdltvelekpasyeeikkalkqasggp
00380511   1/1  ............kaakevgkilpelnlkltgtavrVPvlnvhvvdltvelekpakveeikevlkqasevp
00408681   1/1  ----------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00365801   1/1  ............gaakevgkilpelngkltgtavrVPvlngsvvdltvelekpasydeikealkkasggp
00455171   1/1  gaak............evgkvlpelnlkvtgtavrvPvlnghvvdltvelekpakydeikevlkkasgvp
00530191   1/1  ----------------------------------------------------------------------
00523551   1/1  gashhgg............kvlpvldlklttmAvrVPttlvhvvdltvelekpataeevlealknapgil
00523261   1/1  ----------------------------------------------------------------------
00417711   1/1  ............gaakavgkvlpelngkltgtavrVPtpnvsvvdltvelekeasveeinealkeasegp
00393151   1/1  niiPt.....stgaakavgkvipelngklt.......gtavrVPtpnvsvvdltvelekpvtveeikeal
00471761   1/1  .....gaakavgkvlpelkgkl.......tgtavrVPtpnvslvdltvelekevtveevnealkeasegl
00511471   1/1  ----------------------------------------------------------------------
00502291   1/1  rhlp..........eieqelgkilg.ldvkvtftphlvpvvrGilatvyvel..gvtaeelrelleefYa
00502281   1/1  ----------------------------------------------------------------------
00511481   1/1  lraYgl.lghrhlpEieqelgklagl.dvkvsftPhlvpvlrGilatvyvelkkgvsaeelrelleefYa
00519021   1/1  ............gaakavgkvlpelngkltglavrVPtpnvslvdltvelekevsveeinealkease..
00523271   1/1  ..........rhlpEieqelgllag.ldvkvlftPhlvpvvrGilatvylelkggvsaeellelleeaya
00519911   1/1  ..................................spspyaasKaaaeallral......gldlvtivrpg
00456451   1/1  ----------------------------------------------------------------------
00353902   2/2  ------------------------CtTngLapllkvlndkfgieevlvttvrratdpqkvkkgpinaivp
00380501   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00396501   1/1  ----------------------------------------------------------------------
00476351   1/1  ...stgaakavgkvlPelkg.......kltglavrVPtpnvsvvdltvelekevtveevnaalkeasegp
00481861   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00516961   1/1  gdqrrspihvd-----------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00458941   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00498201   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00353901   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
00460031   1/1  veevrellanapglvkvvllddpasllyptpldvsgkdevlvGRirkdl---------------------
00408691   1/1  sleeirellkeapgvvlvddllvseellyptpldatgtldvlvGrlrkd---------------------
00529791   1/1  lvddldrglyptpldvtgsdavlvGriRkdlllpnglslwvvgDnllkG---------------------
00359531   1/1  llddlelplypkpllavged...vgrirpdldrdagldeglwvvadnlrkgaAlnav-------------
00415971   1/1  vsveeirellkeapglvlvvllddpeeplvptplnatgglsvfvgrlrk---------------------
00530201   1/1  vlddp..llpptpldavgkdevlvgrirkdlsvpnglnlwvvaDnlrkG---------------------
00528181   1/1  ----------------------------------------------------------------------
00359461   1/1  lkgilg.........yteddvvsvgrirddlssifdaglvilsdnlvkgaalnd----------------
00529781   1/1  ----------------------------------------------------------------------
00380231   1/1  lkdilgytedpvvssd......fvgrirs..sifdalalialsdnlvKlaawnd----------------
00380511   1/1  lkgil..........gygedevvvgdirsdslssifdalalivlgdnlvkgaal----------------
00408681   1/1  ----------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00365801   1/1  lkg..........ilgytedevvsgdfrsdsyssifdalalialndnlvklaal----------------
00455171   1/1  lkd..........ilgytedevvsgrirsdslssifdalalivlndnlvklaal----------------
00530191   1/1  ----------------------------------------------------------------------
00523551   1/1  lidededltstael...gefdvdvgrirndlvelvvwgdslwvvgdnlrklaalnae-------------
00523261   1/1  ----------------------------------------------------------------------
00417711   1/1  lkgil.........gyteedlvsvdfigddlssifdagltivldnlvklaawy-----------------
00393151   1/1  keasegplkgilgytedplv......ssdfvgrprssi..fdalativlgdnlv----------------
00471761   1/1  .........lkgilgyteeplvsvdfigdphssifdalativlgdnlvkllawy----------------
00511471   1/1  ----------------------------------------------------------------------
00502291   1/1  gepfvrvldlgeypepkavvgtnfvdigvirdd..rtgrlvlvsv-------------------------
00502281   1/1  ----------------------------------------------------------------------
00511481   1/1  gepfvrvlp...dgelpelkavvgtnfvdlgvavddrggrl-----------------------------
00519021   1/1  .......gplkgilgyteeplvsvdfigddlssifdalativlgdnlvkllawy----------------
00523271   1/1  gepfvrvlp...lgelpetkavvgsnfvdigvfvdd..rggrlvv-------------------------
00519911   1/1  lvlgpllspllgealllpgllllg----------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00353902   2/2  npitipshhgkdvkkvlpdlkvtatavrV-----------------------------------------
00380501   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00396501   1/1  ----------------------------------------------------------------------
00476351   1/1  lkgilgytedplvssdfvgdphssifdalativlgdnlvkllaWy-------------------------
00481861   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00458941   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00498201   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00353901   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AELKFELK--------------------------------------------------------------
00460031   1/1  ----------------------------------------------------------------------
00408691   1/1  ----------------------------------------------------------------------
00529791   1/1  ----------------------------------------------------------------------
00359531   1/1  ----------------------------------------------------------------------
00415971   1/1  ----------------------------------------------------------------------
00530201   1/1  ----------------------------------------------------------------------
00528181   1/1  ----------------------------------------------------------------------
00359461   1/1  ----------------------------------------------------------------------
00529781   1/1  ----------------------------------------------------------------------
00380231   1/1  ----------------------------------------------------------------------
00380511   1/1  ----------------------------------------------------------------------
00408681   1/1  ----------------------------------------------------------------------
00356801   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00365801   1/1  ----------------------------------------------------------------------
00455171   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00523551   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------
00417711   1/1  ----------------------------------------------------------------------
00393151   1/1  ----------------------------------------------------------------------
00471761   1/1  ----------------------------------------------------------------------
00511471   1/1  ----------------------------------------------------------------------
00502291   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00511481   1/1  ----------------------------------------------------------------------
00519021   1/1  ----------------------------------------------------------------------
00523271   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00353902   2/2  ----------------------------------------------------------------------
00380501   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00396501   1/1  ----------------------------------------------------------------------
00476351   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00521831   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00458941   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00498201   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00353901   1/2  ----------------------------------------------------------------------