[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56217.1


[Show Plain Result]

## Summary of Sequence Search
   1::581
   6::320  1.4e-73 32.4% 0042281 00422811 1/1   ransporter transmembrane region         
   1::327  7.4e-67 31.3% 0053060 00530601 1/1   ransporter transmembrane region         
 342::555  3.3e-60 36.9% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
 333::573  1.6e-58 33.2% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
 342::572  6.1e-58 34.6% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
 342::574    5e-57 36.6% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
 342::574  9.6e-57 35.6% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
 336::573  1.4e-56 34.5% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
 338::569  3.6e-56 32.9% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
 334::574  4.2e-56 34.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
 342::578  1.1e-55 33.3% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
 330::570  8.4e-55 32.9% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
 342::569  1.9e-54 34.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
 336::558  1.8e-53 36.7% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
 318::556  2.8e-53 35.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
 338::555  8.5e-53 35.5% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
 340::551  1.9e-52 34.8% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
 334::574  2.8e-52 33.1% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
 330::558  3.1e-52 35.0% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
 331::556  9.7e-52 34.1% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
 336::558  1.2e-51 35.8% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
 281::559  1.3e-51 36.6% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
 299::537  2.2e-51 34.3% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
 326::566  4.5e-51 34.1% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 336::558  3.6e-50 36.6% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
 342::558  6.4e-49 35.0% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
 299::573  1.4e-48 34.3% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
 340::555  1.4e-48 33.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
 342::558  5.7e-47 36.9% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 334::544  9.6e-45 32.5% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
 327::557  3.5e-44 36.4% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
 353::566  2.2e-42 36.5% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
 351::566  1.9e-41 35.3% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 356::565  4.1e-40 37.6% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 359::547  3.5e-39 41.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
 342::557  1.2e-37 40.7% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
 342::564  1.1e-36 38.6% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
 317::559  4.2e-36 33.7% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
 342::559  9.8e-35 38.7% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
 326::557  1.7e-34 32.5% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
 328::570  7.6e-34 28.0% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
 326::557  1.4e-33 28.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
 342::557  3.3e-33 30.7% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
 342::555  6.3e-33 33.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 361::518  8.6e-32 36.0% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 294::551  1.6e-31 27.7% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
 359::581  2.3e-31 34.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 350::575  2.8e-31 34.3% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
 338::558  4.5e-31 27.7% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
 350::556  6.5e-30 32.3% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
 348::558  2.4e-29 34.3% 0053253 00532531 1/1   arboxykinase-like                       
 355::503  2.6e-29 34.7% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 350::556  7.8e-29 33.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 349::554    2e-28 33.0% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
 356::529  4.8e-28 40.1% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
 329::558  2.3e-27 33.9% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 360::507  1.2e-26 39.5% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 359::556  1.4e-26 35.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
 360::527  3.2e-25 30.7% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
 355::556  4.6e-25 32.2% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
 345::553  4.7e-25 29.3% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
 362::555  1.6e-24 32.3% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 360::524  9.9e-23 32.7% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 347::528  1.8e-22 33.5% 0047552 00475521 1/1   arboxykinase-like                       
 353::561  1.8e-22 34.2% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 347::536  3.8e-22 31.6% 0047841 00478411 1/1   arboxykinase-like                       
 335::539  4.3e-22 28.0% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
 360::567  1.4e-20 26.6% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
 360::521    2e-20 32.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 342::450  4.5e-20 33.0% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
 306::555  5.3e-20 24.4% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 329::557  1.3e-19 25.8% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
 309::549  3.5e-19 28.9% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 355::537  4.2e-19 23.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 360::563  8.7e-19 33.3% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 360::576  2.6e-18 26.6% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 347::531  3.1e-18 25.9% 0047844 00478441 1/1   arboxykinase-like                       
 360::546  3.7e-18 28.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 321::558    8e-18 28.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
 363::555  1.5e-17 32.5% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 360::551  1.9e-17 29.1% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
 362::548  2.5e-17 20.9% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 359::542  2.7e-17 32.7% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
 316::552  3.2e-17 26.8% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 313::552  3.7e-17 29.3% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
 338::529  4.9e-17 30.4% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 348::464  8.5e-17 31.6% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 332::565  1.2e-16 27.1% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 342::557  2.2e-16 25.2% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
 358::576  8.7e-16 21.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
 360::568  2.3e-15 29.8% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
 348::558  2.4e-15 30.5% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
 355::529  6.4e-15 32.7% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
 353::549  7.3e-15 24.4% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 357::467  8.6e-15 27.9% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
 342::542    9e-15 26.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
 359::528  6.6e-14 32.5% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 361::553  7.8e-14 25.6% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 353::552  1.2e-13 25.5% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 347::531  1.6e-13 35.6% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 353::550  1.6e-13 24.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 353::524  2.3e-13 30.7% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
 318::559  3.9e-13 28.8% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
 353::575  3.9e-13 20.0% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
 354::531  4.7e-13 29.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
 359::496  2.2e-12 35.1% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 338::531  5.1e-12 25.8% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
 356::547  1.2e-11 24.1% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
 320::531  1.5e-11 29.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 360::570  3.1e-11 20.9% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
 360::559  7.3e-11 26.8% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
 348::538    8e-11 27.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 317::531  8.5e-11 27.6% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
 351::529  1.2e-10 29.3% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 362::551    2e-10 25.0% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
 311::538  2.1e-10 24.1% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 361::515    6e-10 21.4% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
 361::543  1.8e-09 27.1% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
 360::455    1e-08 23.3% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
 166::529  2.7e-08 21.7% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
 354::531  5.3e-08 29.4% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
 361::551  5.5e-08 21.9% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
 354::496    9e-08 22.8% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 355::543    9e-08 21.9% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
 357::496  1.1e-07 29.3% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
 360::574  1.9e-07 26.4% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 334::531  2.6e-07 25.0% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
 339::542  2.6e-07 21.6% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
 355::563  4.5e-07 22.6% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
 361::546  4.7e-07 23.3% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 338::532  5.1e-07 24.8% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
 358::549  5.8e-07 22.8% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
 360::496  9.5e-07 29.9% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
 360::532  1.7e-06 24.3% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
 354::399  2.5e-06 37.0% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 302::497  2.8e-06 27.7% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
 329::497  2.8e-06 26.5% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
 360::432  3.2e-06 29.0% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
 338::539  4.6e-06 21.8% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
 349::530  7.8e-06 21.3% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
 362::497    1e-05 26.0% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
 345::385  1.2e-05 34.1% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 347::529  1.6e-05 27.0% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
 360::546  2.3e-05 23.0% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
 357::546  2.9e-05 24.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
 360::400  3.4e-05 39.0% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
 356::400  3.5e-05 39.5% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
 360::407  4.3e-05 35.4% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
 360::542  4.4e-05 28.4% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
 360::400  6.1e-05 35.1% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
 361::497  6.8e-05 24.6% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
 348::383  8.7e-05 38.9% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
 312::536  9.3e-05 21.1% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
 360::400  0.00014 36.8% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
 360::430  0.00026 25.8% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
 349::408  0.00027 36.7% 0045376 00453761 1/1   p containing nucleoside triphosphate hy 
 357::395  0.00054 35.9% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 360::400   0.0006 38.9% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
 361::405  0.00095 30.0% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
   1::581


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSLFYLLLAAFGM
00422811   1/1  -----ekeekrllrylkpykkllllalllallaallslllplllgrlidallpgg.dlslllllalllll
00530601   1/1  ep..kRllrylkpykkllllalllsllaallslllplllgqlidalllgg.dlsdpllllstllllllll
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVD
00422811   1/1  lallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsrltnDveaidellssll
00530601   1/1  lllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdktstGdllsrltnDveaidellss
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVT
00422811   1/1  ltllralltllgalivlfy.lswrlalvlllllpllllltllfgkrlrklsrlvqealselnsvlvesls
00530601   1/1  llltlllalltligalivlfl.iswklalvlllllpllllltllfgkrlrklsrlaqealselnsllves
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  -------------------------iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkg
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTF
00422811   1/1  girtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvlllgallvlngeltvg
00530601   1/1  lsgirtvkafgaeerelerfdealdellkaslklarlsallspllellsalalalvlllgaylvlngelt
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  lelgirp...............................................................
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEET
00422811   1/1  dlvafllyalqllgplsqlgsllselqrarvaaeRi....------------------------------
00530601   1/1  vgdlvafllyalrllgplrqlgsllselqralaaaerifelld.P.E-----------------------
00422801   1/1  -------------------------------------------------------------llllllall
00482201   1/1  ----------------------------------------------------llllelknlsksyggvla
00530591   1/1  -------------------------------------------------------------llllllale
00490801   1/1  -------------------------------------------------------------lllllllla
00510251   1/1  -------------------------------------------------------------lllllllll
00379581   1/1  -------------------------------------------------------lepllevenlsksyg
00509431   1/1  ---------------------------------------------------------Mlelknlslsnfr
00482261   1/1  -----------------------------------------------------lllevenlsksyggvla
00458601   1/1  -------------------------------------------------------------lllevenls
00475891   1/1  -------------------------------------------------lllelllevknlsksyggvla
00475991   1/1  -------------------------------------------------------------lllaaelpe
00378981   1/1  -------------------------------------------------------lpllelenlsksygg
00424961   1/1  -------------------------------------lgepldglgplr.papgllelenvsksygtgia
00367901   1/1  ---------------------------------------------------------lelknlslsygks
00390411   1/1  -----------------------------------------------------------Mknlslrygnf
00502741   1/1  -----------------------------------------------------lllevenlsksyggvla
00500441   1/1  -------------------------------------------------lllelllelknlsksyggvla
00466971   1/1  --------------------------------------------------llalllevknlsksyggvla
00420701   1/1  -------------------------------------------------------lpllelenlsksypg
00379601   1/1  llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvldlls
00436511   1/1  ------------------ievpvglallgrvldllgepid....gkgplelgepllevenlsksyggrkl
00440861   1/1  ---------------------------------------------Mpllslgepllelenlsksyggvva
00425571   1/1  -------------------------------------------------------lelenlsksyggvla
00404101   1/1  -------------------------------------------------------------elenlsksy
00468691   1/1  ------------------lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksy
00466931   1/1  -----------------------------------------------------------Mkllslslgnf
00485451   1/1  -------------------------------------------------------------skiygd.ea
00436071   1/1  -----------------------------------------------------pllelenlsksygg.la
00361211   1/1  ----------------------------------------------plellgepllelenlsksyggita
00468601   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  -------------------------------------------------------------allelenls
00422141   1/1  -------------------------------------------------------------glsygdpea
00372301   1/1  ------------------------------------yvlPllsdgmpllelenlrkpy.......ggllv
00437981   1/1  -------------------------------------------------------------lveklrpkn
00488521   1/1  ---------------------------------------------lllllalelllevenlristgikel
00368501   1/1  -----------------------------------------------kerllllelrnvllddviGqeea
00367481   1/1  ---------------------------------------------yvrPelldepllelengrhPllsks
00498251   1/1  -------------------------------------------------------------vekllglal
00496111   1/1  -------------------------------------------------------------elenltkly
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  -------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgiv
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ---------------------------------------------------------------------a
00503371   1/1  ---------------------------------------------------------Mmlkslelknfks
00495371   1/1  ---------------------------------------------------------------------e
00532531   1/1  -------------------------------------------------------------------vla
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ---------------------------------------------------------------------p
00371631   1/1  --------------------------------------------------------------------ms
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ------------------------------------------------lrplveklrpknlddvygqeev
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------yygdvt
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ------------------------------------------------------------------evla
00490731   1/1  ----------------------------------------------------------------------
00478411   1/1  ------------------------------------------------------------------Ggvl
00379961   1/1  ------------------------------------------------------yrpvdfdd.ivGqeea
00533501   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  -------------------------------------------------------------skryggkla
00368571   1/1  -------------------------llgvrllpplppklagllplagladgdglgvllGkll.......d
00379261   1/1  ------------------------------------------------drllleelrpvllddviGqeea
00503741   1/1  ----------------------------fifldlrplallplpdrlvgrdeeiealskalgg.......a
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478441   1/1  ------------------------------------------------------------------aevl
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------asdelekllelrp.....vlledvigqeea
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  -----------------------------------eklrpvllddvvgqeeakeallealaga....rla
00406781   1/1  --------------------------------plveklrpvllddvigqeeakeallealaglrlllk..
00356411   1/1  ---------------------------------------------------------lknlsksygilka
00495771   1/1  -------------------------------------------------------------------kga
00404191   1/1  ---------------------------------------------------vellpkvtlddlvgleelk
00489571   1/1  -------------------------------------------------------------rvknlsksy
00439861   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00513251   1/1  -------------------------------------------------------------------iel
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  -------------------------------------------------------------sksygglla
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ------------------------------------------------------------------lgll
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  -------------------------------------lrpvllddvigqeeakeallealalplkrld..
00480251   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ---------------------------------------------------------vtlddvv.gqeea
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ---------------------------------------lvslleslelplleklrpvllddv.vgreea
00532471   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  -------------------------------------------------------------------npf
00386741   1/1  ------------------------------------klrpvllddvvgqeeakeallealkavll.....
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ------------------------------vlektgipltkllrpvllddviGqeealeallealrr...
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  ......................................................................
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00473941   1/1  -----------------------------------------------------eklrpvllddvvgqeev
00416171   1/1  ----------------------------------------------------------diigqeeakkal
00533151   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ---------------------------------------------------------aselvqwlldlgi
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ---------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqy
00418301   1/1  ------------------------------------------------drplleklrpvllddviGqeea
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ---------------------------------------------------------edleslllnplvk
00410531   1/1  --------------------------------------------------------------------ge
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------ygglll
00474201   1/1  ------------------------------------------------------------------deel
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  -------------------------------------------------------------------pra
00476651   1/1  -------------------------------yeplveklrpvllddlvgqeeakealleala........
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  --------------------------------------------------------------------vw
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LTDIHFSLAKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
00422811   1/1  ----------------------------------------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00422801   1/1  llllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGe
00482201   1/1  lkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslkelrgigyvvqqdall
00530591   1/1  elpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg
00490801   1/1  lllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLl
00510251   1/1  aeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKST
00379581   1/1  gvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldglditalslaelrrrgigyvf
00509431   1/1  vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdliflgslirsgadrasv
00482261   1/1  lkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslaelrgigyvfqqdall
00458601   1/1  ksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditglspqelrrlgg
00475891   1/1  lkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglsllellrrgigyvfqdpa
00475991   1/1  lgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00378981   1/1  vlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllllslaelllllrrgigy
00424961   1/1  lidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglv
00367901   1/1  ilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgllllprstvatvel
00390411   1/1  ralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrgadkasvelvfeldgg
00502741   1/1  lkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelrgigyvfqqlall
00500441   1/1  lddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdildlsl..lrrgigyvfqdpal
00466971   1/1  lkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelllllrrgigyvfq
00420701   1/1  ggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldllllslaellalrrgig
00379601   1/1  ldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltledl
00436511   1/1  vlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelir
00440861   1/1  lkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggkgvT
00425571   1/1  lkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl..lrrrigyvfqdpal
00404101   1/1  ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalslaelrrgigyvf
00468691   1/1  gtgialidvsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr..elrelrrrigyvf
00466931   1/1  ralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdilalspeellrllrrrigyv
00485451   1/1  lkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlvigldifrlsarelrk
00436071   1/1  lkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.....lrrgigyvfqdpal
00361211   1/1  lddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalslaerlragigyvfqdl
00468601   1/1  --dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaae.rlgigavpqdvpl
00448931   1/1  LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla...areqlgivfqd...
00485931   1/1  -----LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.......rr..igavpqlpvl
00426051   1/1  --------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlggesglllrdlrrliglv
00469451   1/1  kiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesl
00422141   1/1  lkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp............ieyvfqspnl
00372301   1/1  lndvsl...pgeivaltGpnGaGKSTllrllaglllpasggilvdgedlr..........igyvfq....
00437981   1/1  ldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi........
00488521   1/1  dkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei...............ggkvlyvdqee
00368501   1/1  kealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakll..gapfiridgseltekdy
00367481   1/1  yggkvvlndislsip.gellvitGPngsGKSTllralaglllpasggilvpgedalll............
00498251   1/1  llieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTtLalrllagl
00496111   1/1  tgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsaeelrerrrrigy
00381441   1/1  ----------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltfls....re
00464791   1/1  lidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg..ligerprevrellglllelgvl
00414121   1/1  --------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgig
00475371   1/1  lddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsarellgllgell.....
00503371   1/1  lkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdlliylsdlirrgagiayveq
00495371   1/1  salellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvdg
00532531   1/1  lkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfyakaigllrrkigyv
00480471   1/1  ----sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilldgkdltlvdtpgiarg
00500611   1/1  gllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeill
00371631   1/1  eliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgkla
00451571   1/1  -----MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl.......lreaiglvtqdgel
00437941   1/1  lkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld..............
00475381   1/1  ---------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrdllgllreglirigy
00457311   1/1  --------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsreelrklrrrigmvf
00484101   1/1  ---------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldldellg.igylfqdvgl
00495031   1/1  ----lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglglip
00462761   1/1  aldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr......lglliglvfqd
00512891   1/1  -----------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....rsarrgigyvfq....
00515531   1/1  ---------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvklqlwDtgGqerfrsl
00475521   1/1  lhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv..dleplrrdigmvfqdpal
00490731   1/1  --dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaee......
00478411   1/1  alhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlglkd...gigmvfqdpa
00379961   1/1  lralslalaagppegvllvGppGtGKstlaralagllppdsg..................rivlvgnlsd
00533501   1/1  ---------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp....lgrgigyvfqdpa
00515511   1/1  ---------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvklqlwDtgGqerfrsl
00387201   1/1  lkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsle
00368571   1/1  gvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgdgr
00379261   1/1  kealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllgapfvevdaselteggyvg
00503741   1/1  ldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg.............kvvyvnvsell
00470731   1/1  ----arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralakel..gagfilid
00493431   1/1  ---------kGelivllGpsGaGKsTllkllagllgptsgvisvggt.treprpgevrg.igyvfqsgal
00499191   1/1  ---------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..............gllvgvvfqddfy
00478441   1/1  alhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvllelrg..rdilmvfqppa
00496571   1/1  ---------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelir..glvfqdpl
00444381   1/1  kkalslalelplkrlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakll..g
00487021   1/1  ------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllra.........gevfqd
00498811   1/1  ---------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltrelvaggglliglifqdfg
00513761   1/1  -----------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanlpeqlgi....dirdli
00477971   1/1  --------hkgelvvlvGPsGaGKsTLlnaLlgllp.tsgvisvsgttr.pprpgevdg.vgyvfqsrel
00392701   1/1  ledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd........................
00406781   1/1  ..dlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase........................
00356411   1/1  lkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkltlwDtgGqesfrklwi
00495771   1/1  lldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle...glvli
00404191   1/1  ealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa.................
00489571   1/1  ggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt...........................
00439861   1/1  -------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle
00489631   1/1  ---------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllrellgel.lgrgigfgfqq
00513251   1/1  lsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr....................
00432181   1/1  ----slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvveldgrkl.........
00510561   1/1  --ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGglprGelvliaGppGs
00420081   1/1  ------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleliyqlplr
00434401   1/1  lddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaelllreglgidfqlp
00464411   1/1  --------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplge...ligevfqdgi
00405881   1/1  ----------gervglvGrpgaGKSTLlnaltglkaivsgyp...........gttldpnlgvvelddgr
00468951   1/1  --lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGglprGelvlivGp
00437921   1/1  lveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvielda
00498531   1/1  --ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglprGsltliaGppGs
00508671   1/1  --hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglil
00420941   1/1  .lglslgirpgkgvllyGppGtGKTtlakalagel..gapfiridgse......................
00480251   1/1  --EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrpsapeqlgilgellg...
00437901   1/1  ---lslgirpgrillLyGppGvGKTtlakalakel..gapvieidaselrd...................
00461621   1/1  --------mkgmiialtGppGsGKsTlaklLaerl....glpfistddlyrevvergtelgklikdyfdp
00367291   1/1  keallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..gapfirvdasellek...
00499331   1/1  -----PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllrepvigagtdigevfqdl
00394721   1/1  leallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrldlsellsv........
00532471   1/1  ---------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivdegrlig
00482721   1/1  ---------kgkiigltGpsGsGKsTlarlLae.l....glpvidtddlyrelvaggtplgerirellge
00527261   1/1  ilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel..gkpviyidlselsskg
00386741   1/1  ......girpgehllLvGppGtGKTtlaralagelgapfvrlda..........................
00477011   1/1  eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnall.............Gldvlpvgggpg
00480441   1/1  -----------rlivllGpsGaGKsTlaklLaellp...glivisvgdttrepregevlgvdyvfvdrel
00402371   1/1  ........rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrldaselle...........
00509891   1/1  ----------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrldldeplgvdr.erlrrvg
00478081   1/1  ----------gkvivltGppGsGKtTlarlLaellkplgggvvvi..dtddlrreairelllgldlleil
00516041   1/1  ---------mlkgklillvGppGsGKtTlaralaeel..glpfvvidaddl..lrgeelgriielfdear
00430121   1/1  ..........ggnvllvGPpGvGKTtlakalagllfpsgvp..firinlselte................
00521551   1/1  ---lslglrpgkgvlLvGppGtGKTtlaralagll..gapfvrlsas.......................
00496061   1/1  ----------gklivltGppGsGKtTlaklLaerl....glpvistddllreevepggtdlgeifqalll
00517691   1/1  ---lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg........................
00511381   1/1  ----llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgielvvsriglvleavg
00478391   1/1  ------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrelvgeggrlgrdlfdedr
00487061   1/1  ---------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlire
00473941   1/1  kkalllalalallrgepgehvlLvGppGtGKTtlaralagllga..........................
00416171   1/1  lealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte..................
00533151   1/1  ----MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddllrelv.pggldigevfqdal
00515351   1/1  ----------mngklivltGppGsGKtTlaraLaerl....glpvistddllreavpg.gtdigelfqdy
00497571   1/1  ldeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdfddiileeakeelllel
00482551   1/1  -------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyi
00476071   1/1  ---------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvllggpllerirellgegyllf
00457851   1/1  ---------PkgklivltGppGsGKtTlakaLaerl....glpvistddllre.avpggtrlgeviqdlf
00409841   1/1  ---lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdp---------------------
00482661   1/1  allakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlf
00418301   1/1  kkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll..grpfirvdaselte...
00491901   1/1  ---------lmkgkiilltGppGsGKttlakaLaeel....glpfidtddllreaklggelaeliedlfv
00462581   1/1  fedivpkvlddleealealaeaklpppkgvllyGppGtGKTtlaralakel..glpfvrinasd......
00410531   1/1  lknlslelkkglkillvGlngvGKTtllkrlaggefv..dygptigvnfktvevdg.vkl..........
00469161   1/1  -----------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdli
00410321   1/1  lkdlslelkkglkilllGlngaGKTTllnrllgge-----------------------------------
00474201   1/1  elleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlaralanelprslp
00519581   1/1  ---------kpkvilltGppGvGKttlarlLakll...glpliidldalaellfgdvgglvvdli.....
00472911   1/1  ------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl............
00478131   1/1  ---------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddl--------------------
00489391   1/1  -----lsikkgklivltGppGsGKtTlakaLaerl....glpvistddll--------------------
00403151   1/1  ---------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvktveidg-------------
00501941   1/1  ---------kl..illtGppGsGKttlaralaeel....glpfidaddllrelv................
00477721   1/1  ---------kpklilltGppGsGKttlaraLaeel....glpfidtddll--------------------
00493171   1/1  ----------mgklivllGpsGaGKsTlaklLaeklglivlsv...gdttrepregevdgv.dyvfvsge
00471271   1/1  ilelesliksllekllellkrlslklkkglkva-------------------------------------
00476651   1/1  .......ggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll.....
00512061   1/1  ---------kkkkgklivltGppGsGKtTlakaLaerl..g.glvvidtd--------------------
00493981   1/1  ---------kpklilltGppGsGKttlaraLaeel....glpfidaddllr.elvgegigllfelaerae
00453761   1/1  vpdeeeglvlalvlsdgslllvkldlllllnplkllgveDlalLsylneasvlhnLkl------------
00401211   1/1  ------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgeler-------------------------
00477561   1/1  ---------kkpkvillvGppGsGKtTlaraLakrlaelgk..gvvvidt--------------------
00523461   1/1  ----------a.kvalvGlpnvGKStLlnallgdk.aivsdipgitrdiqtgtle---------------


                         -         -         +         -         -         -         -:490
query           FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILEP
00422811   1/1  ----------------------------------------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00422801   1/1  illdgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararalellellplg
00482201   1/1  psltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldp
00530591   1/1  kditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlld
00490801   1/1  kllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..............lllaakea
00510251   1/1  LlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..............lllaak
00379581   1/1  qdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgldtlldrlvgeLSgGq
00509431   1/1  elvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpqdpnllfqltvlenl
00482261   1/1  psltvlenlllgllllgellllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallld
00458601   1/1  vvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgledlldrlpse
00475891   1/1  lfpgltvlenlllgll....llglalkeaalralllllllgletlldrlvseLSgGqrqrvalarallld
00475991   1/1  dlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllllllgletlldrlp
00378981   1/1  vfqdpalfpgltvrenlalglllaglskaeaaaraaellell.....glddlldrlvgeLSgGqrqrval
00424961   1/1  fqdpplfprltvaenialgaeyf....rdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaia
00367901   1/1  ifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltvlenlllglelrrk
00390411   1/1  llallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfplltv
00502741   1/1  psltvlenlalgllllglskaeaaaraaellell.....gledlldrlpseLSgGqrqrvalArallldp
00500441   1/1  fpgltvlenlllgllllglslaeaaeralelllllgl....edlldrlvseLSgGqrqrvalarallldp
00466971   1/1  dpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlldrlvseLSgGqrqrvalaral
00420701   1/1  yvfqdpalfpgltvrenlalglllaglskaeararalellell.....glddlldrlvgeLSgGqrqrva
00379601   1/1  lelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel.....
00436511   1/1  elelaelrrrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalare
00440861   1/1  rdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddglteldlellkllkelgkpv
00425571   1/1  fpgltvrenlalgllllglskaeaaaralellell.....glddlldrlvgeLSgGqrqrvalarallld
00404101   1/1  qdpalfpgltvrenlalgll.........kaeararalellell.gldelldrlvgeLSgGqrqrvalar
00468691   1/1  qdpalfpeltvlenlalgallag.....................lglaeyldelgkdLSgGqrqrvalAr
00466931   1/1  fqepalfpgltveenlllglllrlllelllgrlelllllllllellallldlllllllllllllllllll
00485451   1/1  rig.vfqdpallphltvpenldlgllleilervlellel...........vgldvvlldtyphelSgGqr
00436071   1/1  fpgltvlenlalgllllgll.....ealaralellellglgdl...drlvseLSgGqrqrvalarallld
00361211   1/1  alfpeltvlenlalg................rarellerlglail...drlpgeLSgGqqqrvaiarala
00468601   1/1  fpsltvldnlalar......dlleaakaagydvvlidtaglld..ldrlvgelsggqkqrvaiarala.a
00448931   1/1  pgltvlenlalgeleararellellgledydvvliDtag.....rlrlpselsggqkqrvaiaralaapl
00485931   1/1  fprltvlenlalg.gadlaeraeellellglegfdvvliDtag..rgrrvgelsggqkqrvaiarallll
00426051   1/1  fqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegldtlaggggvvlsGgqr
00469451   1/1  eqlrrrigyvfqdpalfp.........................aeellelvgledlldrlpge....lSg
00422141   1/1  fpl...............................................qlsgGqrqrvalaralrqdP
00372301   1/1  .................................llerv.gledlldrlpstlsgGqrqrvai.ralatep
00437981   1/1  rrgiglvfqliglfphltvlelvalglggilveevrellkel.......................lsgGq
00488521   1/1  slfpltvlenlalg..gedveellerlgldlldrlph...............qlsggqrqrvaiaralae
00368501   1/1  vGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggdlggllteavlealri
00367481   1/1  ...................................rvdeiltrvglsdl..ldrglslsggerqrvalar
00498251   1/1  lkpgggvvyidgeesldll...rarrlgvvlqelllfpeltveenl........................
00496111   1/1  vfqepalfpeltvlenlalgll...........................drlpgeld..lSgglqrqrva
00381441   1/1  eigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellell....gldadlviilp
00464791   1/1  f.............................aaellervglvaatadeppgelsggqrqrlaiAraladdq
00414121   1/1  yvpqtlglfpaltvlellalall......................lredpdlilid.....sgGqkqrla
00475371   1/1  .......................................gldvlvgarggdlsgglrqr..larallgdp
00503371   1/1  efdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliellldlsggelnrvalllqge
00495371   1/1  ldltglspa..rggiglvfqteallppltvrenlealgldlrglld....rerviellelvgleelldrl
00532531   1/1  fq..lfpfltvlenvalgldglvdeedleraenllalvgleeipnrypse.......lsgGqqqrv....
00480471   1/1  rlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvilllnkidllddrllrra
00500611   1/1  ggkvlyisleeslrrrrigmvfqelgldpdltv.................arerviellelvgllelldr
00371631   1/1  lddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa.eqlkrigllfqkg
00451571   1/1  llelidegilvpdeiv.iellrealeelda..d.gvildgfprllgqaelllsggkadlvifldaplevl
00437941   1/1  ..................................................pselsggerqrvliaralla
00475381   1/1  vfqdyalfprltvlenvllgll.............................llgglvvildggvrqrlal
00457311   1/1  qdpalflnpgltvrenlaeplrllklgkk.............llepvglpevldryphelsgGqrQRv..
00484101   1/1  lpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalplilelrelsdgqiqrvapa
00495031   1/1  lggkvlyiglelt.lsperlrlraqsl....................gldldellerllvidll.elvgl
00462761   1/1  pdllpfltvlenvllpllaaglivivdgt.lllvglrealrkll..........gl.lsgGqkqrvadlv
00512891   1/1  ...tveellgllaelvgle.................vrgeleellktlikelsggekqrvalarallakp
00515531   1/1  wilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiDlleakera
00475521   1/1  fplltvrenvilgllelaglskaealarvdellelvglddellldrlp.......sggqqqeilrvaial
00490731   1/1  ......................................lgldvllgarggdlsgglrqrla..rallgdy
00478411   1/1  lfplltvrengvalglllagl.skaeieervdlllelvglddlldrypde....lsggqrqrvaiarala
00379961   1/1  lldpkdlrellragiplvflnfaalpasllesel.....................lsggerqrvalaral
00533501   1/1  lfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalara
00515511   1/1  wllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvl
00387201   1/1  eallllfldeileidglllvelregigyvf----------------------------------------
00368571   1/1  svrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepe..ptldellellsel
00379261   1/1  edlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvl
00503741   1/1  dlkellrll...............................lealglpppyqlsggerlrvalaeallalg
00470731   1/1  gddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpd.vildgagrtpeqlealldllee
00493431   1/1  fphlivagnllegaevhgllygtskerveeale..kgllvlldr.............dlsggqqlrvala
00499191   1/1  lllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprllsggqrqrvaia.....dp
00478441   1/1  lfpllevrglniaevlelaglska.ealkrvdlvlelvgld.......drypyelsggerqrvailr..v
00496571   1/1  lldeltvlenlalgrylhl.glilaalaagvgv..vldrv.glsdlaygfprtlsglgqrqrvalarall
00444381   1/1  vpfiridgselte.........kelvGe..........................................
00487021   1/1  yalfphltvlelldnvllgleirgllk.aerlervevllervgl......lldrippalsgGqgqrvild
00498811   1/1  lfelldrellielllenlalglal....egvildalrrrllelldll.gldvvilegplllsgglrqrpd
00513761   1/1  dletvme.lglgpngalvfaleellttldillealelleedydyiliD....tpGglelrallalllaia
00477971   1/1  fpeltvagnfleg...........aevrgnlygtsrerveelleagldvlldidpqglsggqkqrlalar
00392701   1/1  ...........................................llgkyvgelsgglrqr..larallakp
00406781   1/1  ...........................................llgkyvgelsgglrqrlalara..adp
00356411   1/1  lyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi.........ilvlNKiDl
00495771   1/1  DtpGfrdtileniekeeleatfeeireadlvllvidaihllepd--------------------------
00404191   1/1  ...................................................delvsklsgglqeqrvaia
00489571   1/1  ............................................................lallelrntt
00439861   1/1  esreqlleraerlgldleellllgllsiliad......................................
00489631   1/1  gdlledatvlenlalllldeidka........................ledggvvlldgfdrsqlqrlai
00513251   1/1  ......................................................gqkqrvalleaalkeg
00432181   1/1  ............................................vliDtpGleefa........sggekq
00510561   1/1  GKTtlalqlaanlaaqggkvlyisteesleql..rarrlgldldrlllld...altv.............
00420081   1/1  ldlgeislddaallllslqllfaapylslnevidaarvlladefikp-----------------------
00434401   1/1  dal........................drellreevlellgl.gevvivdvydlsggerqr...aralas
00464411   1/1  lfpdltvlenvalgrygll.glikealaegviv..ildrv.glsdla..ypgflsggeqqrvaiarallp
00405881   1/1  qlvlvDtpGliel.aslgeglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgk
00468951   1/1  pGsGKTtlalqlaanlaklggkvlyidteesldqlr...arrlgldlddllllpaltveellala.....
00437921   1/1  sdl..rgvddlreligevlqalglllgg..........................................
00498531   1/1  GKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldellllpaltveellala.........
00508671   1/1  sdedraalrrrlgevfqelllagrlvvldgtalgl.elrdelrellkeaglpll.vvfldaplevlleRd
00420941   1/1  ...........................................llgkyvgelsgglrqllalara..akp
00480251   1/1  ................vpvvgvltgldlagalrealellllegydvvliD....tagglqrglllalala
00437901   1/1  .....................................vddlsgyvge....lsggeklrellaealteav
00461621   1/1  galvpd.llirlllerllfldeg..................ggflldgfprtleqaealskpavlsggrk
00367291   1/1  ................................................................lvgege
00499331   1/1  llaggllvddev....................rrlllealdell.laggkvvildgfpggllqrealrrl
00394721   1/1  ...........................................sdlvg....elegglrgllteala..l
00532471   1/1  lvfqdldllpllevlellaa............................rleellerippalsggqgqrvi
00482721   1/1  gyllpdealfrallaellfgdllalalldgvv..............ydrlrdellaelsggqgdvliieg
00527261   1/1  yvdleellrela................................eelgellellkkllkklsellglsil
00386741   1/1  .................................................selsggeklrgllarala.kp
00477011   1/1  trrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenrala.......gpiagisrda
00480441   1/1  feelivag......nlledaivhgllygtskerieealdaglgvlldgfprglsqaqalrlaldlvllld
00402371   1/1  ............................................fgkyvgafegglrqllglaraa..kp
00509891   1/1  elalllaggglcalvaddlagaleellarala...........ggpdviliE.gagl..lplpliellrd
00478081   1/1  f..............................................eglllsdefrelleealalladg
00516041   1/1  elvpelallfideidell.akgkvvildgt.grll-----------------------------------
00430121   1/1  ........................................kllvselighppg.yvGedelgvlfeaark
00521551   1/1  ..........................................elvgkyvgelegglrqllalaraa..np
00496061   1/1  agellfddevlgll............rerldelielllaggvvildgfpldlegalllrealarallpdl
00517691   1/1  ...........................gtlllllgllsfllalvldslplerergitidvalarllldgr
00511381   1/1  lffaldllelll.........................................................q
00478391   1/1  llfrellideidl......................................................lla
00487061   1/1  lllrlgfgepdafdnellgellealleg..........................................
00473941   1/1  .....................................pfielsasdllg......esdlrggfkqa....
00416171   1/1  ......................................dlleselfghekgafgggekqrlgllrla..d
00533151   1/1  eaglllfddefrglller.......................leellargpvvildgfpggllqrealrrl
00515351   1/1  llfpfltvdeni.................rglllealeellaagkvvild...glsggllqrvallrall
00497571   1/1  lelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfirvn...............
00482551   1/1  steeafsperlreralsl.......................gldleelldrllvidat.dlldlleller
00476071   1/1  dealdrellaallfglelegal..............................ldglvygvlqdrllerll
00457851   1/1  llggllffdeldel................lkerieellaaggvildgfpldlegaealreallragplp
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ddlvgqeeakeallenlklf.lkgpellldl..glpkgrgllLyGPpGtGKTtlakalanel...ggpvi
00418301   1/1  ael..............................................................vGyes
00491901   1/1  prellidlikel----------------------------------------------------------
00462581   1/1  ...........................................................llvgllvg.el
00410531   1/1  ...............................................viwDtaGqerfrsllarylrgad
00469161   1/1  lvpdllvlellaan.............raglrelikellaagkgvildrfplsrlayqlsggerqrlaid
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  glpfvrvnasdltd..vglleellgkllgaat......................................
00519581   1/1  ..................................................dleaverhlldiaeelleng
00472911   1/1  ...............................................gllfedaleagfrqrladliral
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ......................................................gesirelfeaagrlap
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  lfkeli...........dagelledaivigllyergtlldavegalldgfpvlldgalqlllllrelllk
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ....................................................eselfgeekeaflgalle
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  flillideid------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGRHEDLLALD
00422811   1/1  ----------------------------------------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00422801   1/1  ldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakgltvll-----
00482201   1/1  kllllDEPtsgLDpetraellellrelakgltvllvthdlsearladrilvlddGrivelgtpeellenp
00530591   1/1  rlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvtHdlsealla
00490801   1/1  alralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraellellrela
00510251   1/1  eaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetraellellre
00379581   1/1  rqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdldealrladrilvldd
00509431   1/1  llgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldglellvglnglldrp
00482261   1/1  pdllllDEPtsgLDpetraellellrelakgltvllvthdlsealladrilvlddGrivelgtpeellen
00458601   1/1  LSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdldealrladri
00475891   1/1  pkllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtpeell
00475991   1/1  seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsealrlad
00378981   1/1  arallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGri--
00424961   1/1  rallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalkrlyPaidvll----
00367901   1/1  lldellgllellalleellklleellkelevleaalaallkeeieeraeellellglgglldrpv-----
00390411   1/1  aenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglkeeaeka---------
00502741   1/1  dllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelgtpeelle
00500441   1/1  dllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGrivelgtpee--
00466971   1/1  lldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivel----
00420701   1/1  larallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGr--
00379601   1/1  .lrnkigyvfQdpvlfpltvren..............................................-
00436511   1/1  llervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdlli-----------------------
00440861   1/1  ilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisaltgegldeltvrenla
00425571   1/1  pdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvlddGrivelgtpe--
00404101   1/1  allllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrladrilvld--
00468691   1/1  .....pvlLllDEptsgldalre..ilellrellkelgytvllvthdls...ladrilvledGsitalgt
00466931   1/1  vlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstLSGGerqrvalar-----
00485451   1/1  qRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthdlreae.adrilv--
00436071   1/1  pdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv----------------
00361211   1/1  ldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdldlldsallrpgkrpl---
00468601   1/1  pevllldeptsgldalae..llelleel..gltvlvvtKlDgtakgghdlslalrladrilvlgvGeive
00448931   1/1  ppevllldeptsglda..lrellellrel..gltvlvvthlDllakggadlslaleladrilvlgdGeiv
00485931   1/1  ldpelllldEptsglda..lrlllellkel..gltvlvvthddgtakggaalslaleladrilvlgdGei
00426051   1/1  qrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerlare-------------
00469451   1/1  Gqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH......---
00422141   1/1  dvillDEprsaldaelllqaadt......GhtvlvttHdlsaaraadrllvlgdgrlllasaldviiaqn
00372301   1/1  sllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaalladrvvvlndgrivavgtpeel-
00437981   1/1  kqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsellpallsrcqvir-
00488521   1/1  elkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvthdldevarladr---
00368501   1/1  klvegelgfrelerevlldlplhdasviallgggrelrdgellkalkeaeaeelle..llglkdlllrkp
00367481   1/1  alatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaalaadrivvlngrvv---
00498251   1/1  ............drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrl---
00496111   1/1  ia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeaedladsg-----
00381441   1/1  asleellerldrrggelsggqkqRvala------------------------------------------
00464791   1/1  gkpvllllDEptsgldalreillllgellseegytvllvshdlslleraadr...eggsit---------
00414121   1/1  laralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselthdlellrel
00475371   1/1  dvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadrilvldlggivlnkld.
00503371   1/1  vdlllldepterldfldelagleeykgnyeellklleeleellkelekrlellekeleeleellerle--
00495371   1/1  pre....lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvt----
00532531   1/1  .......illldEPtsgLdpvsr.........................leladriyvllsGrivesgt--
00480471   1/1  eaeerieellelv---------------------------------------------------------
00500611   1/1  lpre....lkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvl----
00371631   1/1  lpealdveellellldlke.........................gledilvpvlsggqkqrlal------
00451571   1/1  leRllkrddekilkrleeqkqrvaiarallkkpailild-------------------------------
00437941   1/1  dpkvlllDEi.daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdviefpppdeeelle--
00475381   1/1  arallldpdvllldepl-----------------------------------------------------
00457311   1/1  .ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlgeagrsadrvl.----
00484101   1/1  rallrdpllllldedtvvldkvdlasildlllellee---------------------------------
00495031   1/1  lelldrlpre....lsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelg----
00462761   1/1  vlldadpevllaReptrgldpeteeeleellerleereplygadiviithdlsieevadrila-------
00512891   1/1  dvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallrrgrivelgpls-----
00515531   1/1  eellellglgdlldklpse....lsgGqkqrval------------------------------------
00475521   1/1  lilpvllgralallpelllldeptsaldpdlveeilel--------------------------------
00490731   1/1  dvliiDtp.gtldvllelallellkellaelgadvvllvvdat.lgleaadrilvlleglgvpgvvlNkl
00478411   1/1  lepelllldeptsaldplavvellelllglnee.ldiilalellll------------------------
00379961   1/1  alrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragit---------------------
00533501   1/1  lvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylellekadrvvvidaggsleevve
00515511   1/1  lllvglfdlldglpse....lsggqkqrval---------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  g.lrdladrleklvagglagllegaektaasilellrkllallldlggpafdlrdllslgegliv-----
00379261   1/1  lldelekahrpirvlllsaslvlllgglglpevgelllellddvgltdllgrtvdfkntiiiltsnv---
00503741   1/1  kpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltthdldllerla-----------
00470731   1/1  ....lgrpvvviilttnrevlldral.rRpgrllldepeldppdree-----------------------
00493431   1/1  ralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivn.ddleealeelldiivv
00499191   1/1  dvlildgptllldpe....................lrpladlvifldaspeelleRllkRgrlergddle
00478441   1/1  llpklllpdepgrnldvlievavlnlilkllgidallelvd-----------------------------
00496571   1/1  kpdlvifldeppteeldeRlrkrl.......rlgdteevlehrleraeeladrlia--------------
00444381   1/1  ........segailsggfkqrvgia..lladpgilflDEidkllddrgeaegggdvsregvqnaLlrl--
00487021   1/1  rallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpeelleR....-----
00498811   1/1  lvifldappevlleRllkRggldeetiekrlelylelaplygaadividndlsleevvdri---------
00513761   1/1  ralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseeglel------------
00477971   1/1  alilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleeale------------------
00392701   1/1  svlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpeeldpal--------
00406781   1/1  gvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndleeldpal--------
00356411   1/1  leekiveellellgleykgdrdpeelsggqkqrvalara-------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  falarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqallrllsrldrvivl
00489571   1/1  eagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrvavldd......Gt---
00439861   1/1  plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqlteli
00489631   1/1  lrallddppdlvvfldapleellerllkRdgrteeeilerlarleery.............radlvivtd
00513251   1/1  ylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvllldegslvdlgvledl--
00432181   1/1  rvalalallreadvlllvvdadeptsfldle....llel-------------------------------
00510561   1/1  ...................eellalaerllsggkvdlvviDsltalapalelsllldep-----------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  gpdvlilDgptlgldv...........lldlpdlvifvdhdlevalerrlkr------------------
00464411   1/1  kpdlvllldepteeldeRllkRgrllekleyikkrleh--------------------------------
00405881   1/1  pvilvlNKiDep....tneldlellellee.lggtvvlvSahdgegldelldailellkgklv-------
00468951   1/1  ...............................erllsggkpqlvviDsltalrpalllldept--------
00437921   1/1  ......................kpdvlllDEi.drldpdaq-----------------------------
00498531   1/1  ...........................erllsggkpdlvviDsltalapslllldepgrv----------
00508671   1/1  rrglypeelsgglkqrvaiarplelaaepdlvi.------------------------------------
00420941   1/1  silllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrpeeldpallrpgRfd-
00480251   1/1  dlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsvalilglpilflgtg
00437901   1/1  lkgkpsvlllDEi.daldpdvlnallklldglrdlsgvlii-----------------------------
00461621   1/1  qrlala----------------------------------------------------------------
00367291   1/1  grlrgalaealradpgvlflDEidalagkrgsgtsrldpev-----------------------------
00499331   1/1  lprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdlielye-------------
00394721   1/1  akpsvlflDEidrlldardsesslevlnaLlrlledg.nvl-----------------------------
00532471   1/1  ldrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyldadpeelleRllkRgr.
00482721   1/1  alllepgllplpdlvifldappevlleRllk..Rggdseeeiekrleryreiaplleaadlvidndgsl-
00527261   1/1  glelilglsggdleelleelaellkklgkpvililDEiqslldvsske----------------------
00386741   1/1  gvlllDEida.ldpdvqeallelleegeltivgggllteld-----------------------------
00477011   1/1  irleielpglpdltlvDtPGlgsvavvdqlsggqkqrva-------------------------------
00480441   1/1  pslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleealelllail---------
00402371   1/1  gvlflDEidsllgarggsgvdpevqnaLlrlleeg..nvrviaatnrp----------------------
00509891   1/1  lldlvvlvvldgivllvdaidrlea---------------------------------------------
00478081   1/1  dvvilDgfgrlldarq..lleelllllleepppdlvifldadpevlleRllkR-----------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  appsvlllDE.idkldpdvlnaLlqlleegevtdlggrv-------------------------------
00521551   1/1  gvlflDEidklapkrsptsglddvsrrrvlnaLlrllegle-----------------------------
00496061   1/1  .vifldapleelleRllkrgrllereddseevlekrlerylelyerliepykkadyvivid---------
00517691   1/1  killlD----------------------------------------------------------------
00511381   1/1  dpdviliDE.aqfldpevvevllelad...tgilvlvtglemdfagelfegsl-----------------
00478391   1/1  kgkvvi----------------------------------------------------------------
00487061   1/1  ..gkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldleevkaleell.....
00473941   1/1  ....akpgvlflDEidrl.drevqnaLlelleelqvtilgg-----------------------------
00416171   1/1  ggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggi..vlpadvrli------------------
00533151   1/1  llrpdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerliepy....eeaddvivid
00515351   1/1  rpdlvifldapleelleRllkR..ddseeeilerleryreeleplleeyddalvvi--------------
00497571   1/1  ..........................................----------------------------
00482551   1/1  lrrl....lsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakel-----------
00476071   1/1  aagpdv----------------------------------------------------------------
00457851   1/1  dlvifldapleelleRllkrgreplddteevilkrlerlrel----------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  .......---------------------------------------------------------------
00418301   1/1  garlrel---------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  egrlrglfteavlanpgvlflDEidrlplkrqaggdllrallealltll---------------------
00410531   1/1  gillvvdatdglsfeevaklleellglaglegvpiilvgn------------------------------
00469161   1/1  legalll---------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ...........................fllakpgvlflD-------------------------------
00519581   1/1  eilildeptvgldskd...ildelakilkevnfelifithdedelrerialraeel--------------
00472911   1/1  lakgkvvild..gtglsreareellellkelg.pvlvifldadpevlleRllkrgr--------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  rellldeidellekg.givildgfllt...........lrellpepdlvvfl------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  pdlvill---------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  rlgklalagggtvlflDE.idkldpdvqnaLlrlleeppsnvrvil------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GWYAQTYQSQQLEMKGEEDAE-------------------------------------------------
00422811   1/1  ----------------------------------------------------------------------
00530601   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  gllytllllgeel---------------------------------------------------------
00530591   1/1  drilvlddGriv----------------------------------------------------------
00490801   1/1  kegktvllvtHdls--------------------------------------------------------
00510251   1/1  lakegktvllvtHd--------------------------------------------------------
00379581   1/1  Grivelgtpeell---------------------------------------------------------
00509431   1/1  lselSgGek-------------------------------------------------------------
00482261   1/1  pgllytllllsslp--------------------------------------------------------
00458601   1/1  lvlddGriveegtpeell----------------------------------------------------
00475891   1/1  enpgllaall------------------------------------------------------------
00475991   1/1  rilvlddGr-------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00502741   1/1  npgllytllllgsl--------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00440861   1/1  lglrlr----------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00468691   1/1  veellddlgdpit---------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00468601   1/1  dgtpfe----------------------------------------------------------------
00448931   1/1  edgtpe----------------------------------------------------------------
00485931   1/1  vedgt-----------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00422141   1/1  lvrr------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00368501   1/1  sqlSgGqkqR------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  adrilvlgdgrivldgppvll-------------------------------------------------
00475371   1/1  .lvakggaalelaee-------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00490731   1/1  d---------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00533501   1/1  eilelle---------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00493431   1/1  lll-------------------------------------------------------------------
00499191   1/1  evlerilervrpdylr------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00404191   1/1  dlppd-----------------------------------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00439861   1/1  ldalagggaleqladg------------------------------------------------------
00489631   1/1  dl......--------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00480251   1/1  envddlevfnpgelv-------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00532471   1/1  dpeeqerldd------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ...........lvl--------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00533151   1/1  asg-------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00453761   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------