[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56317.1


[Show Plain Result]

## Summary of Sequence Search
   1::514
   5::266  6.2e-83 43.8% 0052054 00520541 1/1   p containing nucleoside triphosphate hy 
   9::266  1.8e-81 42.9% 0050449 00504491 1/1   p containing nucleoside triphosphate hy 
   1::274  1.4e-66 34.8% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
   5::292  1.7e-60 36.0% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
   1::274  1.5e-52 36.8% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
   8::274  3.7e-47 36.0% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
   5::196  1.1e-46 34.7% 0050423 00504231 1/2   p containing nucleoside triphosphate hy 
   2::286  1.6e-46 34.8% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
   8::277  1.9e-46 31.8% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
   1::190  1.9e-45 35.1% 0051648 00516481 1/2   p containing nucleoside triphosphate hy 
   7::274  7.8e-45 34.0% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
   8::289  5.5e-43 35.0% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
   3::268  4.7e-42 33.7% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   6::194  5.1e-41 36.1% 0049292 00492921 1/2   p containing nucleoside triphosphate hy 
   6::266  1.6e-35 34.9% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
   8::194  1.1e-34 32.7% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
   6::301  1.7e-32 23.7% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
   3::269  8.3e-32 32.0% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
   2::282    1e-29 27.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   6::192  1.1e-29 28.7% 0046551 00465511 1/2   p containing nucleoside triphosphate hy 
 249::382  1.1e-29 37.2% 0052053 00520531 1/1   lation proteins                         
  11::191  3.7e-29 29.6% 0048180 00481801 1/2   p containing nucleoside triphosphate hy 
   5::192  8.5e-29 31.5% 0050482 00504821 1/2   p containing nucleoside triphosphate hy 
   5::189  1.6e-28 29.4% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
   2::189  2.5e-28 29.7% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
   8::195  1.1e-27 28.6% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
   5::199  1.6e-26 30.1% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
  11::180  2.5e-26 29.0% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
   7::272  3.2e-26 28.9% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
   4::267  7.8e-26 30.5% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
   1::181  1.1e-25 29.7% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
   5::263  2.6e-25 32.5% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
  11::197  1.1e-24 30.1% 0049868 00498681 1/2   p containing nucleoside triphosphate hy 
   8::267  1.7e-24 31.4% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
  11::181  1.2e-23 27.2% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
   8::195  1.4e-23 26.2% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
   3::265  1.8e-23 29.0% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
   9::265    6e-23 22.0% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
   8::267  7.9e-23 31.6% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
  12::186  9.4e-23 25.0% 0052346 00523461 1/2   p containing nucleoside triphosphate hy 
   9::267  1.3e-22 27.5% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
   4::265    5e-22 22.1% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
   9::266  3.6e-21 27.4% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
   5::267  4.2e-21 28.2% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
  11::264  4.6e-21 26.5% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
   4::273  9.1e-21 24.7% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
   2::268  1.4e-20 25.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
   2::264  6.6e-20 25.0% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
   8::267  8.9e-20 27.6% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
   8::266  1.3e-19 24.7% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
   8::161  1.4e-19 28.0% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 276::383  2.2e-19 34.0% 0050448 00504481 1/1   lation proteins                         
   1::262  2.6e-19 29.4% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
   5::276  2.7e-19 24.1% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
  10::264  4.2e-19 23.9% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
   9::272  6.7e-19 26.1% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 231::380  8.5e-19 33.9% 0048252 00482521 1/1   lation proteins                         
   6::272    2e-18 24.0% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
   6::268  4.4e-18 26.2% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
   2::268    7e-18 25.0% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
   7::193  8.5e-18 25.0% 0052625 00526251 1/2   p containing nucleoside triphosphate hy 
   9::269  1.9e-17 25.8% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
   4::269  2.4e-17 28.0% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   4::192  2.9e-17 26.8% 0052724 00527241 1/2   p containing nucleoside triphosphate hy 
 382::455  6.4e-17 31.1% 0052056 00520561 1/1   C-terminal domain-like                  
   6::188    8e-17 27.2% 0051104 00511041 1/2   p containing nucleoside triphosphate hy 
   9::188  9.3e-17 26.9% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
   6::267  1.2e-16 24.7% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
   4::270  1.3e-16 29.4% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
   5::185  2.8e-16 24.4% 0052841 00528411 1/2   p containing nucleoside triphosphate hy 
   6::191  2.9e-16 27.0% 0052502 00525021 1/2   p containing nucleoside triphosphate hy 
   9::188  3.1e-16 29.4% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
   7::268  3.2e-16 23.5% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
   6::273  3.4e-16 23.4% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
   7::188  4.1e-16 26.4% 0048154 00481541 1/2   p containing nucleoside triphosphate hy 
   7::269  4.8e-16 27.7% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
   9::268  4.9e-16 24.5% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
   6::267  9.9e-16 22.2% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
   7::265    1e-15 25.2% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
   8::200    1e-15 26.2% 0053196 00531961 1/2   p containing nucleoside triphosphate hy 
 280::376    1e-15 26.0% 0037246 00372461 1/1   lation proteins                         
   7::266  1.1e-15 23.6% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
   8::195  1.6e-15 25.9% 0051704 00517041 1/2   p containing nucleoside triphosphate hy 
   9::180  2.6e-15 26.0% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
   8::265  2.7e-15 23.9% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
   2::268    3e-15 20.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
   7::277    3e-15 26.9% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
  11::193  3.1e-15 28.0% 0052914 00529141 1/2   p containing nucleoside triphosphate hy 
 380::455  3.3e-15 32.9% 0048253 00482531 1/1   C-terminal domain-like                  
  11::270    4e-15 28.3% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
 382::455  5.8e-15 31.1% 0046824 00468241 1/1   C-terminal domain-like                  
   7::185  6.1e-15 24.5% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
   9::270  1.3e-14 21.0% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
   9::150  2.2e-14 26.6% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
   8::191  2.3e-14 25.3% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
   5::264  2.9e-14 23.1% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
  10::197  6.5e-14 24.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  12::270  1.1e-13 28.9% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
   8::264  1.2e-13 24.8% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
  12::189  1.2e-13 26.5% 0051450 00514501 1/2   p containing nucleoside triphosphate hy 
   1::162  3.3e-13 23.2% 0041400 00414001 1/2   p containing nucleoside triphosphate hy 
   1::187  3.4e-13 24.7% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
   8::186  5.2e-13 24.7% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
   6::188  5.9e-13 21.1% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
   9::192  6.5e-13 22.8% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
   6::192  1.1e-12 24.2% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
   8::192  1.1e-12 25.7% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
   8::267  1.1e-12 25.6% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
  11::265  1.1e-12 27.4% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
   9::192  4.5e-12 25.3% 0052785 00527851 1/2   p containing nucleoside triphosphate hy 
   8::186  5.8e-12 23.1% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
   2::190  6.1e-12 23.0% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   8::270  6.4e-12 24.7% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 285::378  6.5e-12 26.7% 0037405 00374051 1/1   lation proteins                         
   9::189  1.4e-11 22.6% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 382::455  1.4e-11 23.3% 0050452 00504521 1/1   C-terminal domain-like                  
  11::186  1.6e-11 22.0% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   9::186  2.1e-11 21.1% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   9::271  3.8e-11 22.1% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
   5::192  4.7e-11 21.6% 0052764 00527641 1/2   p containing nucleoside triphosphate hy 
 279::373  7.3e-11 25.0% 0045034 00450341 1/1   lation proteins                         
   9::193  1.5e-10 27.2% 0047547 00475471 1/2   p containing nucleoside triphosphate hy 
 280::377  2.9e-10 23.4% 0040119 00401191 1/1   lation proteins                         
 283::377  8.1e-10 26.4% 0039670 00396701 1/1   lation proteins                         
 282::375  1.6e-09 25.3% 0051646 00516461 1/1   lation proteins                         
   8::274  9.4e-09 25.6% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
   1::232  1.6e-08 22.2% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
  12::274  6.8e-08 21.9% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 282::373  2.4e-07 25.9% 0050420 00504201 1/1   lation proteins                         
  14::281    5e-07 29.9% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
 279::375  8.7e-07 22.8% 0049110 00491101 1/1   lation proteins                         
 283::369  2.7e-06 28.8% 0046538 00465381 1/1   lation proteins                         
 280::376    2e-05 25.5% 0036237 00362371 1/1   lation proteins                         
   1::154  3.1e-05 25.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  10::163  6.8e-05 26.2% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   2::151  0.00011 19.6% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 284::415  0.00017 18.9% 0037975 00379751 1/1   lation proteins                         
 216::286     0.56 22.5% 0041400 00414002 2/2   p containing nucleoside triphosphate hy 
 241::268     0.76 42.9% 0049292 00492922 2/2   p containing nucleoside triphosphate hy 
 240::280      0.8 27.5% 0051648 00516482 2/2   p containing nucleoside triphosphate hy 
 241::274     0.82 29.4% 0052625 00526252 2/2   p containing nucleoside triphosphate hy 
 241::271      2.1 32.3% 0052914 00529142 2/2   p containing nucleoside triphosphate hy 
 241::270      2.2 36.7% 0050423 00504232 2/2   p containing nucleoside triphosphate hy 
 241::267      2.3 44.4% 0052346 00523462 2/2   p containing nucleoside triphosphate hy 
 241::270        3 30.0% 0052724 00527242 2/2   p containing nucleoside triphosphate hy 
 219::287      3.6 24.6% 0047547 00475472 2/2   p containing nucleoside triphosphate hy 
 241::273      4.5 33.3% 0050482 00504822 2/2   p containing nucleoside triphosphate hy 
 241::269      4.8 34.5% 0052502 00525022 2/2   p containing nucleoside triphosphate hy 
 241::273      5.4 33.3% 0046551 00465512 2/2   p containing nucleoside triphosphate hy 
 241::272      7.6 34.4% 0048180 00481802 2/2   p containing nucleoside triphosphate hy 
 241::267      7.6 33.3% 0051450 00514502 2/2   p containing nucleoside triphosphate hy 
 241::275      9.3 33.3% 0052785 00527852 2/2   p containing nucleoside triphosphate hy 
 241::269      9.6 31.0% 0048154 00481542 2/2   p containing nucleoside triphosphate hy 
 241::266       12 34.6% 0051104 00511042 2/2   p containing nucleoside triphosphate hy 
 241::274       15 27.3% 0051704 00517042 2/2   p containing nucleoside triphosphate hy 
 241::270       16 30.0% 0052764 00527642 2/2   p containing nucleoside triphosphate hy 
 241::279       19 32.4% 0049868 00498682 2/2   p containing nucleoside triphosphate hy 
 241::266       22 34.6% 0052841 00528412 2/2   p containing nucleoside triphosphate hy 
 241::280       25 23.1% 0053196 00531962 2/2   p containing nucleoside triphosphate hy 
   1::514


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSS
00520541   1/1  ----ldlerirniaiiahvdaGKTtltealllytgaiskagevd....dgaavlDwmelEreRgitikss
00504491   1/1  --------rirniaiighvdaGKTTlteaLllytgaiskagevk....dgaavlDwmelEkergitikss
00411701   1/1  kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytgiiseagevdl......tvtDtledEreR
00374071   1/1  ----lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslllaavldsleeer
00431331   1/1  ledlldlllllllllllslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgkgs
00396721   1/1  -------krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfllllvldsldeer
00504231   1/2  ----mk.kklrnvaivGhvnvGKsTLlnrLlgelglidk...............dvaiverergiTidia
00372481   1/1  -dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevkla.....lvldsleeerergitidsg
00362391   1/1  -------krirnvaivGhvdvGKtTLlnaLlgllgaivgdv......allalvldslkeerergiTidig
00516481   1/2  lk.llelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakklgevdd.glllaivldkle
00369581   1/1  ------kkrirnvaiiGhvdvGKsTLlnaLlgalgaiv......sdvadlalvldllklerergitidig
00469361   1/1  -------MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttr..ldsleeerergitid
00517691   1/1  --lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfllalvldslpler
00492921   1/2  -----e.kkirnvaivGhvnaGKtTLlnrLlgek...................ldilseerergitidsa
00401211   1/1  -----elkrglnvgivGhvgaGKSTLlnaLlgll...................ldtlkgelergitikig
00484261   1/1  -------kkllkialvGhpnvGKStLlnrl.......................tgekv....pgttgaid
00357861   1/1  -----kkdklfkillvGdsgvGKTtLlnrllg......................deflveyiptigidfy
00409841   1/1  --lslelkkglkvalvGrpgvGKSTLlnaLlga.....................dlaivsdipgttrdpi
00471271   1/1  -prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallg...............
00465511   1/2  -----ekkrllkvalvGlpnvGKStllnallgakfai.....................vedepgitidin
00520531   1/1  ----------------------------------------------------------------------
00481801   1/2  ----------akialvGlpnvGKStllnallga.....................dfaivedtpgttidin
00504821   1/2  ----eklrllk.valvGlpnvGKStllnallgakfai.....................vedepgitidin
00515101   1/1  ----pleelllslllkkllkvalvGlpnvGKstllnrll.......................ggkfvere
00488191   1/1  -fllsllrrlslllkrllkvalvGlpgvGKStLlnall....................gakflakvsptp
00494851   1/1  -------ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnall...................
00515821   1/1  ----glllllllslelkkllkvalvGlpnvGKstLlnrll.........................gakfv
00526911   1/1  ----------rkvalvGlpnvGKStLlnrllgakvs........................e.pgtTigin
00442331   1/1  ------kkkllkivlvGdpgvGKstLlnrllg......................de.fvedyagttgdni
00519271   1/1  ---sllsslllkkllkvalvGlpnvGKstllnrll.........................ggkfseygtT
00514481   1/1  alllslllkkllkvalvGlpnvGKstllnrllg.........................gkfseygtTidi
00528591   1/1  ----sallllllelkkllkvalvGlpnvGKstLlnrll.........................ggkfsey
00498681   1/2  ----------llkvalvGlpnvGKStllnallg......................dkfivsnipgitidp
00361531   1/1  -------kkllkivlvGdpgvGKstllnrll.......................gnefvedypgttgdli
00511561   1/1  ----------lkvalvGlpnvGKStllnall.....................gadfaiventpgttidik
00517931   1/1  -------kkllkvalvGlpnvGKstllnrllg........................dkvsdepgtTidin
00374121   1/1  --gellrlslllkkllkvvlvGlpnvGKstLlnrll.....................ggdf....depgp
00515621   1/1  --------kelkvlllGlsgvGKTtllnrll........................ggefleeygpTigvn
00399991   1/1  -------kkelkvvlvGdpgvGKstLlnrll.......................ggefvedypgttgdfl
00523461   1/2  -----------akvalvGlpnvGKStLlnall......................gdkaivsdipgitrdi
00402391   1/1  --------kelkvlllGlpnvGKstllnrll.....................ggdf....depgtTigvn
00366991   1/1  ---klelkkllkillvGlpgvGKTtllnrll.....................ggef....eeyvptigin
00514711   1/1  --------kelkvvlvGdpgvGKtsllnrllg......................defiveyiptigvdfl
00449901   1/1  ----kkkkkllkillvGdsgvGKStLlnrllg......................gkfivsyiptitvdil
00407471   1/1  ----------lkvllvGlpnvGKsTLlnrll.....................gdkv....dkpgtTigin
00507921   1/1  ---sskkkkllkivlvGdsgvGKtsLlnrllg......................defiveyiptigvdfl
00410321   1/1  -dlslelkkglkilllGlngaGKTTllnrll........................ggefp.eygptigin
00378621   1/1  -rlslllkkglkvllvGlpgvGKstllnrla.....................geef....dtpgttigin
00370451   1/1  -------kkllkillvGdpgvGKstLlnrllg......................defiveyiptitvdfl
00358141   1/1  -------kkelkvllvGdsgvGKstLlnrll.......................ggefvedyapttgddi
00470231   1/1  -------elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl...................
00504481   1/1  ----------------------------------------------------------------------
00424711   1/1  lrlslllkkglkvalvGlpnvGKSTLlnaLl.....................gakvaivsdipgtTrdiv
00444161   1/1  ----ekkdklfkillvGdsgvGKttLlnrllg......................defiveyiptigvdfy
00362791   1/1  ---------elkilvvGdsgvGKttLlnrllg......................gefiveyiptigvdfy
00447401   1/1  --------kelkivlvGdsgvGKttLlnrllg......................nkfivsyiptitvdil
00482521   1/1  ----------------------------------------------------------------------
00520021   1/1  -----lkkkllkivvvGdsgvGKttLlnrllg......................gkfieeyiptigidfy
00444821   1/1  -----elkkllkvllvGlpgvGKttllnrll.....................ggefai....ygptigin
00387321   1/1  -rlklelkkllkillvGlpgvGKTtllnrllg.........................defveygptigin
00526251   1/2  ------kdkllkvvlvGdpgvGKstLlnrllg.....................gef.iveyiptitvdfl
00403151   1/1  --------kglkivlvGdsgvGKTtLlnrllg......................defpvsyiptigvdfy
00432181   1/1  ---slelkkglkvalvGrpgvGKStLlnallg.....................lkvaivsdypgttrdpt
00527241   1/2  ---mse.lkllkvvlvGrpnvGKstLlnrllg......................gk.fvedypgttgdfl
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  -----e.kkllkvvlvGrpnvGKstLlnrl.......................lggkfvedypgttgdfl
00518311   1/1  --------gelkvvlvGdpnvGKssLlnrll.......................ggkfvedypgttgdti
00514601   1/1  -----lkkkllkivlvGdsgvGKTsLlnrllg......................gefiveyiptigvdfy
00518321   1/1  ---msslelkkllkvvlvGdpnvGKstLlnrll.....................ggkf..vsdypgttvd
00528411   1/2  ----sllkkllkvvlvGrpnvGKstLlnrll.....................ggkfaivsyiptitldfl
00525021   1/2  -----eldkllkvvlvGdpnvGKssLlnrll.......................gdvfvsdypgttgdfl
00528321   1/1  --------dkllkvvlvGdpnvGKssLlnrll......................ggkfivsyiptiltld
00527351   1/1  ------kdkllkivlvGdsgvGKttllnrllg......................gefiveyiptigvdfl
00526151   1/1  -----elkkllkvvllGdsgvGKTtllnrllg......................gkfieeyiptigvdfg
00481541   1/2  ------glkkllkvvlvGdpnvGKstLlnrll.......................ggvfvsdypgttgdf
00463921   1/1  ------l.kllkvvlvGdpnvGKssLlnrll.......................ggkfvsdypgttrdfi
00378841   1/1  --------kelkillvGdsgvGKstLlnrllg......................defiveyiptigvdvy
00455591   1/1  -----kkdkllkilvvGdsgvGKttllnrllg......................gefiveyiptigidfy
00514611   1/1  ------lkkllkvvlvGdpgvGKttLlnrllg......................gefiveyiptigvdfl
00531961   1/2  -------kkllkvvlvGdpnvGKstLlnrl.....................lggkf..vsdypgttgdfi
00372461   1/1  ----------------------------------------------------------------------
00514621   1/1  ------lkkllkvvlvGdsgvGKtsLlnrllg......................gefiveyiptigvdfy
00517041   1/2  -------kkllkvvlvGdpnvGKstLlnrl......................lgdkfivsyiptitrdfl
00514581   1/1  --------kelkvvlvGrpnvGKssLlnrllg......................gkfivsyiptitrdfi
00526801   1/1  -------kkelkvvllGdsgvGKtsLlnrllg......................gefiveyiptigvdfy
00356411   1/1  -dislelkkgikilllGlsgsGKSTllnrllgle............................ygpTigin
00492691   1/1  ------GlkkllkvvlvGdpnvGKStLlnrl.......................lggkfvsdypgttrdf
00529141   1/2  ----------llkvalvGrpnvGKstLl.rl.......................lggkfvedypg.tigd
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------lkvalvGlPNvGKSTLfnal.....................tgak.aivanypftTrdpn
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  ------lskkelkvvlvGdpnvGKssLlnrl.......................lggkfvsdypgttgdn
00519521   1/1  --------kelkilllGlpnvGKstllnrllgeefdkp.........................gpTrgvn
00497591   1/1  --------kglkvvlvGrsgvGKStLlnall................gekvakvsdisatlgrgpgttrd
00528791   1/1  -------kkkllkvvlvGdpnvGKstLlnrllg......................gkf.vsdypgttrdf
00412341   1/1  ----lkkkkllkillvGdsgvGKtsLlnrllg......................gefiveyiptigvdfl
00405881   1/1  ---------gervglvGrpgaGKSTLlnal.....................tglk.aivsgypgttldpn
00517841   1/1  -----------hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnallgrdflpvssgpg
00387311   1/1  -------kkllkillvGdsgvGKtsLlnrllg......................gefiveyiptigvdfl
00514501   1/2  -----------lkvvlvGrpnvGKstLlnrllg......................gkfivsyiptitldf
00414001   1/2  rrlllelkmllrvgivGlpNvGKSTLfnaLt.....................gakvaivanypftTldpn
00410531   1/1  gelknlslelkkglkillvGlngvGKTtllkrlag.........................gefvdygpti
00494041   1/1  -------kkeikilllGlgnvGKttllnrllggefdep.........................gpTigvn
00525281   1/1  -----kkdkllkvvlvGdsgvGKTsLlnrllg......................gefiveyiptigvdfy
00481131   1/1  --------lelkvvlvGdpnvGKssLlnrllg......................gk.fvsdypgttrdfi
00352811   1/1  -----lekkelkilllGlgnvGKsTllnrllgge........................f..ergpTigin
00495821   1/1  -------akelkvlllGlsnvGKttllnrl...........................kfvety.pTigvn
00514591   1/1  -------kkllkvvllGdsgvGKTsLlnrllg......................gefiveyiptigvdfy
00520981   1/1  ----------glkvvlvGdpnvGKstLlnrllg.gvfvsdy......................pgttgdf
00527851   1/2  --------lelkvvlvGdpnvGKstLlnrllg..gkfvsdy....................pgttgdni.
00507751   1/1  -------dlkllkvvlvGdpnvGKssLlnrllg..gkfvs.....................dyppttgdf
00490731   1/1  -dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaeelgldvll
00414121   1/1  -------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqll.........edlgv
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  --------kgekvallGlsgsGKSTllnrllglef..........................aygpTigpt
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvm
00515511   1/1  --------kgekvlllGlsgsGKSTllnrllg........................lefl..pgpTigpt
00525011   1/1  --------kelkvvlvGdpgvGKssLlnrll......................ggefvedylpttgddf.
00527641   1/2  ----lkkkkllkivllGdsgvGKTsllnrllg......................gefveeyiptigvdfy
00450341   1/1  ----------------------------------------------------------------------
00475471   1/2  --------mglkvalvGlPNVGKSTLlNaL.....................tgak.aivanypgtTrdpn
00401191   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  -------psrkelklvvvGdsgvGKTsLlnrllg......................gkf.ekyvptvgvd
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00477011   1/1  -----------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnall..Gldvlpvgggpg
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  -------------aivGrpnvGKStLlNaLl.............gekv.gfaivs.....gvpgtTrdiw
00491101   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00495771   1/1  ldilldilkgktvalvGpsGvGKStLlNaLlg................ellattgeipgdggdgrhtTrd
00387941   1/1  ---------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglegeplgladl
00448931   1/1  -dvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla..........areqlgiv
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQTXKLFEVVKHRGIPVFTFMNK
00520541   1/1  avsleykgylinliDTPGhvdFseeveralrvlDgAvlvvdaveGvevqTetllrqalkygipiivfiNK
00504491   1/1  avslewkgylinliDTPGhvdFseeveralrvlDgavlvvdaveGvepqtetllrlarkygvpiivfiNK
00411701   1/1  giTikssatslewelieelllelkldidgkgylinliDTPGhvdFsseveralrvaDgailVvDavegve
00374071   1/1  ergitidiaavsfetdgrkitliDtPGhvdfikevirglsvadgallvvdavegefeaglsvepqtrevl
00431331   1/1  lllalvldsldeErergiTidiaavsfetdgrkitliDtPGhedfikevirglsvadgallVvdasegvl
00396721   1/1  ergitidiaavsfetkgrkltliDtPGhedfrkevirglrvadgailVvdasdgesfagievepqtrell
00504231   1/2  lvilelkgrklnliDtPGhedfsslvlralrvadgallvvdatdgvtpqtlevlllllllgvpiivvlNK
00372481   1/1  avsletdgrkinliDtPGhedfskevlrglavadgallVvdaadgvspqteevlllarllgvpkiivvlN
00362391   1/1  avtletdgrlitliDtPGhvdfvkevlrglrvadgailVvdavegvmpqtrehlllarllgvpkiivviN
00516481   1/2  lerergitidsaavsfetdgrkinliDtPGhedfvkevlrglrvadgallVvdategvepqtrevlllar
00369581   1/1  lvsleldglkitliDtPGhedflkevlrglavadgallVvdategvlpqtrevlllakllgvpniivvlN
00469361   1/1  sglvkfelng..lnliDtPGhedfrsltlrylrgadgallVvdatdgvsfqtlellelllelgvpiilvl
00517691   1/1  ergitidvalarllldgrkilllDtPGhedfvkevlralrladgallvvdadegvslpqtrevlllllll
00492921   1/2  attleldgrdlllllllgklllllllslellkqlnliDtPGhedfssevlralrvadgallVvdatdgvs
00401211   1/1  aasllldklaivsdtpgttldpilgvleldgpkllllDtPGhedflkellralaladgallvvdadegef
00484261   1/1  ii.gtveldgvklnliDtpGqedfrslverylrgfleeadgvllVvdatedregfeeqtkellellrllg
00357861   1/1  tktveidgkkvklqiwDtaGqerfrslrslyyrgadgvllvyditdgesfeelkkwleellrlapnvpii
00409841   1/1  lgvvlldgrdllllDtPGlidfaseptnlldleiieallraleeadvvllvvdadrglleqdlellelll
00471271   1/1  ......gdfaevgptpgtTrdikvvtvegkgvkltliDtpGlgdpaslqeefralvlrylrlrgadavll
00465511   1/2  lg.veldgkvkltliDtpGlidgapellqedfralvlrylrgadgvllvvdatd.lleqllelleellel
00520531   1/1  ----------------------------------------------------------------------
00481801   1/2  lgvveldgvkltliDtpGlidgaseglqedfrslllrylrgadvvllvvdatdglleqdlellellrelg
00504821   1/2  lgtveldgkklvliDtpGlidgaselqedfrkltlrylrgadvvllvvdatdglfeqtlellellrellp
00515101   1/1  ptitidi..gtveldgvkltlvDtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellell
00488191   1/1  gttrdik..tveldg.kltliDtPGlgdllviielaslledfrsltlrylrgadvvllvvdatdglleqt
00494851   1/1  .gakflakvsptpgttidiklgvl...gvkltliDtpGlgdldviielaerlrdlvreylralrgadgvl
00515821   1/1  srgpTiginlgtveldgvkltlvDtpGqedfrslvlrylrgadgvllVvdatdresfegveeqleellel
00526911   1/1  fgtvelkdgklvkltliDtpGqedfraellrsylrgadgillVvdatdpesgfeeltkellellrelgll
00442331   1/1  vktveldgkkvklnlwDtpGqedfrslvelylrgadgvllVvdatdresfegvkkwleeilrllplanvp
00519271   1/1  iginfgtveldgvklvlvDtpGqedfraltlrylrgadgvllvvdatdresfegveeqleellelllllg
00514481   1/1  nfgtveldgvklvlvDtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellelllllgvpi
00528591   1/1  gtTiginfgtveldgvkltlvDtpGqedfrslrlrylrgadgvllVvdatdresfegvekqleellellr
00498681   1/2  nvgtveldgkvkltliDtpGlidpaslqedfrslllrylrgadvillvvdatd.lsfedleklleelrel
00361531   1/1  vktveldgkkvklnliDtpGqeefrslrerylrgadgvllVvdatdgesfeelkewleeilellpladvp
00511561   1/1  lvvvelkgvklvliDtpGlidgalelqerflslrvlrylrgadvvllvvdatdglfeqleellellr..g
00517931   1/1  fgtveldgvkltlvDtpGqerfrslrllylrgadgvllvvdatdrdsfeglkeqllellelllllgvpii
00374121   1/1  TiginfgtveldgvkltliDtpGqeefrsltlrylrgadgvllVvdasdgdsfeevlelleellelllla
00515621   1/1  fvtvdlkdvklqlwDtaGqerfrslwelyyrgadgvilVvdatdrdsfeevkkwleellelallagvpil
00399991   1/1  vktveldgktvkltlwDtpGqeefrslrerylrgadgvllVvdatdresfeglkkwleeilellllagvp
00523461   1/2  qtgtle....kltliDtpGllltkllegalldllerflrslllsylrgadvvllvvdatdlesfesvlll
00402391   1/1  vgtveldgvklqlwDtpGqerfrsltllylrgadgvllVvdasdgdsfeellkwleellelllllgipii
00366991   1/1  fvtveikgvklqlwDtaGqerfrslwllylrgadgillVvdatdgdsfeevakwleellnlagladvpil
00514711   1/1  tktvevdgktvklqlwDtaGqerfrsltelyyrgadgvllVvdvtdresfenlkkwleellelae..dvp
00449901   1/1  tktveldgkkvkltlwDtpGqeefrslrelyyrgadavllvvdatdpesfenlkkwleellelldlllla
00407471   1/1  lgtveldgvkltlvDtpGqerfrslwlrylegadavilvvdasdpdsfeelkelleellellllagvpii
00507921   1/1  tktievdgkkvklqlwDtaGqerfrslrelylrgadgvllVydvtdresfedlkkwleellellelpdvp
00410321   1/1  vgtveldgvklqlwDtaGqerfrsllllylrgadgvllVvdatdgdsfeevkellleilelaglagvpii
00378621   1/1  fgtveldgvklqlwDtpGqerfrsltlrylenadvvllvvdasdpdsfeellelleellellllagvpii
00370451   1/1  tktveldgklvklqlwDtaGqerfrslrelylrgadgvllvvdatdresfedlkkwleeilellp.agvp
00358141   1/1  tktveldgkkvkltlwDtaGqerfrslrelylrgadgvllVvdvtdgesfeelkkwleeilnllpladvp
00470231   1/1  ........kivsdpgtTigv.vgtveldgvklqlwDtaGqerfrsltlrylrgadavllVvDasdydlvl
00504481   1/1  ----------------------------------------------------------------------
00424711   1/1  lgvl...gkklvliDtPGllefaseleglgkklverflryleeadlvllVvdasdglseq..........
00444161   1/1  tktvevdgktvklqlwDtaGqerfrslrelyyrgadgvllVydvtdresfenlkkwleeilrllp.sgvp
00362791   1/1  tktvevdgkkvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleellklle.sgvp
00447401   1/1  tkeveidgkrvklllwDtpGqeefrsllelylrgadgvllVvdatdpesfenlkkwleellellglllla
00482521   1/1  ----------------------------------------------------------------------
00520021   1/1  tktvevdgkkvklqiwDtaGqerfrslrelyyrgadgvilvydvtdresfenlkkwleeilelle.snvp
00444821   1/1  fgtveldgvklqlwDtaGqerfrslwllylrgadavllVvdatdgdsfeelkellleilellllagvpii
00387321   1/1  fvtvdlkgvklqlwDtaGqerfrslwllyyrgadgillVvdatdgdsfeevaklleeilelaglenvpii
00526251   1/2  vktveldgktvklqlwDtaGqerfrslrelylrgadgvllvvdvtdpesfedlkkwleellelld.snvp
00403151   1/1  vktveidgkklvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfenvlswleelrellgllll
00432181   1/1  lgvveldgrklvliDtpGleefasggekqrvalalallreadvlllvvdadeptsfldlellellrelll
00527241   1/2  lktveldgklvklqlwDtpGqerfrslrllylrgadgvllVvdatdpesfeglkkwllellellelagvp
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  lktveldgkkvklqlwDtpGqerfrslrllylrgadgvllvvdatdpesfeglkkwllellellelagvp
00518311   1/1  lktveldgklvklqlwDtpGqerfr.ltllylrgadvvllvvdatdresfeglkkwllellellelagvp
00514601   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfenlkkwleellelap.snvp
00518321   1/1  fnvktveldgkkvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfeevdeellellrelglgv
00528411   1/2  lgtveldgkkvklvlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlkkwleellelleagvpi
00525021   1/2  vktveldgklvklqlwDtpGqerfrslrllylrgadgvllVvdatdgesfedlkkwleellellelagvp
00528321   1/1  fivktveldgkkvtllllqiwDtpGqerf..ltllylrgadvvllvvdatdgesfedlkkwleellelle
00527351   1/1  tktieldgkkvklqlwDtaGqerfrslrelyyrgadgiilVydvtdresfenlkkwleellellp.snvp
00526151   1/1  tvtleledlylklvlvdgknvklqlwDtaGqerfrslrplyyrgadgvilVydvtdresfenlkkwleel
00481541   1/2  ivktveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfeeldeellellrellagvp
00463921   1/1  vktveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldeellellrelgpgvpi
00378841   1/1  tktveidgkkvklqlwDtaGqerfrsllelyyrgadgillvvdvtdresfeelkkwleeilrlle.agvp
00455591   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgillvydvtdresfeelkkwleeilrlle.snvp
00514611   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvllvvdvtdresfedlkkwleellelle.pnvp
00531961   1/2  vktveldgktvklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlleelleelrellpgvpi
00372461   1/1  ----------------------------------------------------------------------
00514621   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfedlkkwleellellepgvpi
00517041   1/2  lktveldgklvklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlekwleellelleagvpi
00514581   1/1  lktveldgkkvklqlwDtaGqerfrdslrelylrgadvvllvvdatdgesfedlkkwleellellklagv
00526801   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellelapanvpi
00356411   1/1  egtieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqlleliln
00492691   1/1  nvktveldgklvkltlwDtpGqerfrslrklyyrgaleailllllglllleleeadvvllVvdatdresf
00529141   1/2  fivgtveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfenlkkwllellellelag
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  lgvvevdderldllaelslkpalgvkpkkivpakivlvDtpGlikgaslgeglgnqflaaireadvillV
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  ilktveldgklvklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfeeldewllellrelgpgvp
00519521   1/1  vgtveiggvkfrlwDtgGqrrfrklwllyfedadaiifvvDasdydqvlledelrnrleellelleeiln
00497591   1/1  iilikldrg.llliDtPGirefglldeeaveltllylegadllllvvdathg.fepdcavlealeeggip
00528791   1/1  nlktveldgklvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfedlkewleelleladllag
00412341   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgiilvydvtdresfenlkkwleeilrlld.pgvp
00405881   1/1  lgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqpvellsggekqrl
00517841   1/1  Ttrptelrlgespellaeflidggekltdldelrkeieeatdallgpgk.................gfsf
00387311   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleeilrlld.pgvp
00514501   1/2  llktveldgkevklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlkkwleellellgagvp
00414001   1/2  lgvvelpderldllaglakpkklvgapvvlvDtpGlie.gaslgeglgrqflaaleeadvilhVvdasdp
00410531   1/1  gvnfktvevdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegv
00494041   1/1  vttftlkgvklqlwDtgGqerfrslwelyfegadaiifvvdlsdgdsflnldkwlnrleeslellesiln
00525281   1/1  tktvevdgkkvklqlwDtaGqerfrslrelyyrgadgvllVvdvtdresfenlkkwleellelleanvpi
00481131   1/1  vktveldgklvklqlwDtaGqerfrsllelylrgadvvllVvdatdresfeeldeelleelrelaagvpi
00352811   1/1  vetfeidgvkftiwDtgGqrdfrklwilyfegadaiifVvdssdydsflnvdkwtnrleealellesill
00495821   1/1  fktveidgvklqiwDtaGqerfrslwllyyrgadaiifVvDlsdrdqvlledelvnsfeevlewleelln
00514591   1/1  tktievdgkkvklqiwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellelap.snvp
00520981   1/1  ivktveldgkkvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeevdewllellrelglnvp
00527851   1/2  lktveldgklvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldewllellrelgpgvpi
00507751   1/1  ivktveidgklvklqlwDtaGqerfrslrllylrgadvvllvvdvtdresfedlkkwleeilellelagv
00490731   1/1  garggdlsggl..rqrlarallgdydvliiDtpgtldvllelallellkellaelgadvvllvvdatlgl
00414121   1/1  lavrlgigyvpqtlglfpaltvlellalalllredpdlilidsgGqkqrlalaralladpdlgellllDe
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  sgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltv
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  elglgpngalvfaleellt...tldillealelleedydyiliDtpGglelrallalllaiaralaadei
00515511   1/1  egtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllv
00525011   1/1  tktvevdgktvklqiwDtaGqerfrsltelyyrgadgvllvydvtdresfedlkkwleellelldllsnv
00527641   1/2  tktievdgknvklqlwDtaGqerfrslrplyyrgadgiilVydvtdresfenlkkwleellelldpnvpi
00450341   1/1  ----------------------------------------------------------------------
00475471   1/2  lgvvelpdgrldllaelvkpkkivpapivlvDtpGliegasegeglgnqflaaireadvilhvvdasegl
00401191   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  yl.ktvevdgklvrlqlwDtpGqerfr.....yyrgadgvllvfdlsdpesfenlkkwlkellellglll
00440861   1/1  tLlnaLl.....................gllkpdegvilvggk.gvTrdivlytle.dgvkltliDtpGl
00477011   1/1  trrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleiel
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  mwivvlieldgrpllliDTpGlgdtekedekelvkiallallladvvllvvd..ggiteqdlellkllle
00491101   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00495771   1/1  vllirle..glvliDtpGfrdtileniekeeleatfeeireadlvllvidaih.llepdlavlealeegg
00387941   1/1  lageadledailetpegldllpaglllaglellrgerlrelleel.addyDvviiDtppglgdl..tlla
00448931   1/1  fqdpgltvlenlalgeleararellellgledydvvliDtagrlrlpselsggqkqrvaiaralaaplpp
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNP
00520541   1/1  lDrlgadllelleeieerlgllvvplqlpigfgsgflgvvdllssfallylkglglklllleipedllel
00504491   1/1  mDrpg.dflelleeirellgl.llplqlpigsgsdfvgvvdllsekallyeggklllllipeellelaee
00411701   1/1  pqteevlrqarkegipiilviNKiDrlgadlllvleelyeklsrlieevnviisglnddllgkllvsplq
00374071   1/1  llalllgvphiivviNKiDlvdadeerlleileellellkklgylpig......................
00431331   1/1  erllelepqtrevlllalllgvphiivviNKiDlldadpleelleeikeelgllllklglpigvgd....
00396721   1/1  llarllgvphiivviNKiDlldadeleevleeieeelgellaklgfplgd....................
00504231   1/2  iDlvdadrleevleeleellkllllpldvpivpisaltgegvdelleailellpll--------------
00372481   1/1  KiDlldadelleevkeelrellkllgllled.......................................
00362391   1/1  KiDlvdaderl...........................................................
00516481   1/2  llgvpriivvvNKiDlvgadeerleevleeieellkllglvpldvpivpv--------------------
00369581   1/1  KiDlvdaeerleevleelrellkllgll..........................................
00469361   1/1  NKiDlvdadeleeleellkklglplelvpllldllldsllldllllgllsslllellelggdll......
00517691   1/1  gvpniivvlNKiDlvdaeeleevleelrellkllglpl................................
00492921   1/2  lpqteevlelllelgvpniivvlNKiDlvdadrleevleeleellkelgfldvp----------------
00401211   1/1  lpqtlevlllllelgvkpiilvlNKiDlvdaelleevleeleellkllglln..................
00484261   1/1  lllllgvpiilvlNKiDlldareveevleelkeelkalakelglpiglesnflg----------------
00357861   1/1  lvgnKiDlldareveealelakel..............................................
00409841   1/1  elgkpvilvlNKiDlldaeellleevl...........................................
00471271   1/1  VvdatdpglfeqdlellkellelfgelagvpiilvlNKiDlldaeeveleeeiaellalllklgelglll
00465511   1/2  gvpiilvlNKiDlldarevsleeleelakklglvpvvevsaktgegvdelle------------------
00520531   1/1  ----------------------------------------------------------------------
00481801   1/2  vpiilvlNKiDlld.vlleeleellkelglppvvpvsaktgegvdelleal-------------------
00504821   1/2  gvpiilvlNKiDlld.drevlleelrellglvpvvevsaktgegvdelfeal------------------
00515101   1/1  rllgvpiilvlNKiDlldaeelrevseelaellakllgipvvetsaktg---------------------
00488191   1/1  lelleellelgvpiilvlNKiDlldaeeleevveeleelllalglgipv---------------------
00494851   1/1  lvvdatdglfeqdlellklllelgvpiilvlNKiDlldeaelevlleelrellke---------------
00515821   1/1  lkllgvpiilvlNKiDlldaeelrevleelaellakelgipvvetSaktgegvdelfea-----------
00526911   1/1  agvpliilvlNKiDlldareveelleelreelkklakelg------------------------------
00442331   1/1  iilvgnKiDllea.........................................................
00519271   1/1  ipiilvlNKiDlldaldlrevleelaellak.......................................
00514481   1/1  ilvlnKiDlldareleevleelaellalllgipvvevsakt-----------------------------
00528591   1/1  llgvpiilvlNKiDlleareveellaelellllllllg................................
00498681   1/2  lpellgvpiilvlNKiDlldaeeleelkellkllgipvvevsaktgegvdelleall-------------
00361531   1/1  iilvgNKiDllere........................................................
00511561   1/1  vpiilvlnKiDlldarellell.lalllglpvvevsaktge-----------------------------
00517931   1/1  lvlNKiDlldalelrevleelaealakelgipvietSaktgegvdelfeallel.---------------
00374121   1/1  nvpiilvlNKiDlldareleellellellllllvs...................................
00515621   1/1  lvgNKiDlldal..........................................................
00399991   1/1  iilvgNKiDlleerevsleealelaeelg.........................................
00523461   1/2  lglkeqllellkllellgvpiilvlnKiDll.adaeeveellaell------------------------
00402391   1/1  lvlNKiDlldal..........................................................
00366991   1/1  lvgnKiDlleal..........................................................
00514711   1/1  iilvgNKiDllda.........................................................
00449901   1/1  gvpiilvgnKiDllerevlleeleelakelgl......................................
00407471   1/1  lvlNKiDlldakllaellellrlv..............................................
00507921   1/1  iilvgnKiDlldr.........................................................
00410321   1/1  lvgNKiDlleal..........................................................
00378621   1/1  lvlNKiDlldaallrevleelalel.............................................
00370451   1/1  iilvgnKiDllda.........................................................
00358141   1/1  iilvgnKiDlleerevseeeglelakelg.........................................
00470231   1/1  lepdsferleewleelrella-------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00424711   1/1  .gkpvivvlNKiDlleaeeleelkkllkflglllegep................................
00444161   1/1  iilvgNKiDllderevskeearelakel..........................................
00362791   1/1  iilvgnKiDlldarevsee...................................................
00447401   1/1  gvpiilvgnKiDlldr......................................................
00482521   1/1  ----------------------------------------------------------------------
00520021   1/1  iilvgnKiDlpea.........................................................
00444821   1/1  lvgNKiDlleal..........................................................
00387321   1/1  lvgNKiDlldal..........................................................
00526251   1/2  iilvgnKiDllearevseeealelakelglpfietSaktgegvdelfealael-----------------
00403151   1/1  egvpillvgnKlDlptnerdvsleealelalel.....................................
00432181   1/1  agkpvilvlnKiDlldar.....eelakl.........................................
00527241   1/2  iilvgnKiDlleerevsleellelakelglpvvetSaktgeg.vdelfeala------------------
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  iilvgnKiDlledrevsleellelakelgipvvetSaktgeg.vdelf----------------------
00518311   1/1  iilvgnKiDllderevsleellelakelglpvietSaktgegnvdelf----------------------
00514601   1/1  iilvgnKiDlpearev......................................................
00518321   1/1  piilvgnKiDlldarellellell..............................................
00528411   1/2  ilvgnKiDlldarevsleellelakelglpvietSaktgegvdel-------------------------
00525021   1/2  iilvgnKiDlleerevsleellelakelglpvvetSaktgeg.vdelfeal-------------------
00528321   1/1  lagvpiilvgNKiDlledrevsleellelakelgipvietSaktgegv----------------------
00527351   1/1  iilvgnKiDlpeare.......................................................
00526151   1/1  lelaelpnvpivlvgNKiDlpdarevseeeaeelakelg...............................
00481541   1/2  iilvgnKiDlldarellellellglllvsleealelakelgavpvvet----------------------
00463921   1/1  ilvgnKiDlldarellell...................................................
00378841   1/1  iilvgnKiDllgr.........................................................
00455591   1/1  iilvgnKiDllde.........................................................
00514611   1/1  iilvgnKiDlpea.........................................................
00531961   1/2  ilvgNKiDlldarellellellelglvsleellelakelgavpvvetSaktgegvdelfe----------
00372461   1/1  ----------------------------------------------------------------------
00514621   1/1  ilvgnKiDlldarevseeealelakel...........................................
00517041   1/2  ilvgNKiDlldarevsleealelakelglpvietSaktgeg.vdelfealaelll---------------
00514581   1/1  piilvgnKiDllearevsleellelakelglpvietSakd------------------------------
00526801   1/1  ilvgnKiDll............................................................
00356411   1/1  ltvlenvpiilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalarala...........
00492691   1/1  eeldlellellrellpgvpiilvgNKiDlldarellell...............................
00529141   1/2  ipiilvgnKiDllearevsleellelakelglpvievSaktgeg.vdelfeal-----------------
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  vDasegltliihvegsvdPvedieiietELiladlellekrleklekkaklggkkllltlalkllkaelk
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  iilvgnKiDlldarellellellglglvsleealelakelglvpv-------------------------
00519521   1/1  llllagkpillvlNKiDlldekllaelledlfpey...................................
00497591   1/1  iilvlnkiDl------------------------------------------------------------
00528791   1/1  vpiilvgnKiDlldrevlleeleelakelglpvvetSaktgegvdelfeal-------------------
00412341   1/1  iilvgnKiDlleerevseeealelak............................................
00405881   1/1  alarallgkpvilvlNKiDeptneldlellelleelggtvvlvSahdgegldellda-------------
00517841   1/1  dtieleielpdlpnltlvDtPGlgsaavgdqpeeleeafraltleylreadtlillvvdasddltesdal
00387311   1/1  iilvgnKiDllee................................................revseeeal
00514501   1/2  iilvgnKiDllearevsleellelakelglpvvetSaktgeg.vdelfe---------------------
00414001   1/2  lgiilvvnkvdpledieiisae------------------------------------------------
00410531   1/1  piilvgnKlDlldalllrevsaelalelakelgikfietSAktgegv-----------------------
00494041   1/1  llllanvpillvgNKiDlleaklleellkllfpeydglndledalk------------------------
00525281   1/1  ilvgnKiDllearevseeealelakelglpffetSaktgegvdelfea----------------------
00481131   1/1  ilvgnKiDlldalsllllllllglrevlleealelakelglvpvietSaktg------------------
00352811   1/1  nrllknvpiilvlNKiDlleeksveeilelleyfpdylgllklldlllllld------------------
00495821   1/1  nallanvpillvgNKiDl........leelakklglkvfetsaktgeg.vee------------------
00514591   1/1  iilvgnKiDllda................................................revseeeal
00520981   1/1  iilvgnKiDlldarellell..................................................
00527851   1/2  ilvgnKiDlldalsllellsllglrevlleealelakelglvpvvetSaktg------------------
00507751   1/1  piilvgnKiDllearevsleealelakelglpfietSaktlgegvd------------------------
00490731   1/1  eaadr.ilvlleglgvp.gvvlNkldlvaeg..gaalelleelgvpilsa--------------------
00414121   1/1  ptlvlDaasgedlldl.lkelaeqlgltvlivlnKiDlls.elthdlellrel.................
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  lenlanvpillvlnKiDlleakeraeellellglgdlldklpselsgGq---------------------
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  llvddptsgldaetqleilelllelllklgipiilvlnKlDllsee------------------------
00515511   1/1  lenlanvpillvlnKiDlleaklvllllvglfdlldglpselsggq------------------------
00525011   1/1  piilvgnKiDllder.......................................................
00527641   1/2  vlvgnKiDlpdarevseeealelakelglpffetSaktgeg.veelfealvr------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/2  tivhveglvdplrdieiilleliladlellekrleklgklakggvkdlleale-----------------
00401191   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  pgipillvgtK.Dlledld...................................................
00440861   1/1  gdtklsdeeklilkyleeadlvllvid.d.glteldlellkllkelgkpvilvlnkiDllkkeelekllk
00477011   1/1  pglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesdalellkellee
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  lgkplilvlnKwDllekeeleell..............................................
00491101   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00495771   1/1  ipvilvlnkldlle--------------------------------------------------------
00387941   1/1  laaadgvllVvdpellalraarr-----------------------------------------------
00448931   1/1  evllldeptsg-----------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDP
00520541   1/1  alearlelleavael..ddellekyleglellleellaalrkallagklvPvlfgs--------------
00504491   1/1  lrealveavaelddelleklleglelteeellealrkavlegklvPvlfgsAlknf--------------
00411701   1/1  gpvvfgsaltgvgfllllfallyakklgldlkellkrlwgdiyfipkdlkdlkkelrltllevl------
00374071   1/1  ..............................................vpvvpvsaltgegvdelldalvel
00431331   1/1  .............................................................vpv------
00396721   1/1  ...............................................vpvvpvSAltgegvdel------
00504231   1/2  ----------------------------------------------------------------------
00372481   1/1  ................................vpvvpiSaltgegvdelldallellpvper..dldkpl
00362391   1/1  ..........elvveellellkklglllelvpvvpvSaltgegvdelldallellpspelrldplll---
00516481   1/2  ----------------------------------------------------------------------
00369581   1/1  .............................gelvpvvpiSaltgegvdelldalvellplpllrl------
00469361   1/1  ..........................................................vvpvSaltgegv
00517691   1/1  .........................................vpvvpiSAltglgvdel------------
00492921   1/2  ----------------------------------------------------------------------
00401211   1/1  .......................................................v--------------
00484261   1/1  ----------------------------------------------------------------------
00357861   1/1  ................................gl.pffetSAktgegveelfealvklilepkllle.kl
00409841   1/1  ...............................eellkllaelggvpvvpiSaltgegvde-----------
00471271   1/1  lndl...........................................................llggvpv
00465511   1/2  ----------------------------------------------------------------------
00520531   1/1  --------------------------------------tglGveeLldaivdllpsP..........kad
00481801   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00442331   1/1  ...................revseeealelakelgl.pvvetSaktgegvdelfeallklll--------
00519271   1/1  ....................................elgipvvetSaktgegvdelf-------------
00514481   1/1  ----------------------------------------------------------------------
00528591   1/1  ....................................llllelaeelgipvvet-----------------
00498681   1/2  ----------------------------------------------------------------------
00361531   1/1  ....................vleeeaeelakelgl..pvvetSaktgegvdelfeal-------------
00511561   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ..........................teealelaeelgl.pvvetSAktgegvde---------------
00515621   1/1  ................slrevseeealelakelgipvfetSAktgegvdelfeal---------------
00399991   1/1  ......................................lpvvetSaktgegvdelfe-------------
00523461   1/2  ----------------------------------------------------------------------
00402391   1/1  ................slrevleelalelakllgipvfetSaktgegvdelfdalle-------------
00366991   1/1  ................sarevseeealelakelgipfvetSAktgegvdelfeal---------------
00514711   1/1  ...................revseeealelakelgl.pvfetSaktgegvdelfea--------------
00449901   1/1  ........................................vpfvetSaktgegvdel-------------
00407471   1/1  .....................lleellllalllgipvvetSAktgegvdellea----------------
00507921   1/1  ....................evseeealelakelgl.pfietSaktgegvdelfealvellle-------
00410321   1/1  ..............garevseelalelakelg..ipvvetSAktgegvdelfdalvel------------
00378621   1/1  .............................akllgipvvetSAktgegvdelfea----------------
00370451   1/1  ................lslrevseeealelakelgl.pfietSaktgegvdelfeal-------------
00358141   1/1  .....................................lipfvetSaktgegvdelf--------------
00470231   1/1  ----------------------------------------------------------------------
00504481   1/1  -----------------------------------------------------------------pPkgd
00424711   1/1  ...................................gdavlapvvpiSaltge------------------
00444161   1/1  ....................................gl.pfvetSAktgegvdelfealvrlllep----
00362791   1/1  ........................ealelakelgl..pfletSAktgegvdelf----------------
00447401   1/1  ...................evleelaealakel....ggipvvetSaktgegvdelfealvk--------
00482521   1/1  --------------------lpataeqlrvpvlygsaldgkgvqpllda....................d
00520021   1/1  ...................revseeealelakelgl.pfietSAktgegveelfealvrlll--------
00444821   1/1  ................slrevseelalelakllgipvfetSAktgegvdelfeallel------------
00387321   1/1  ..............llrevleelglelakelg..ipffetSAktgegvdelfealadl------------
00526251   1/2  ----------------------------------------------------------------------
00403151   1/1  .......................................gllpvievSaktgegvdelf-----------
00432181   1/1  ......................................lgvpvvevSaktgegvdelle-----------
00527241   1/2  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514601   1/1  .....................seeealelakelgl..pffetSaktgegvdelfeal-------------
00518321   1/1  ......glllvsleealelakelga............vpvvetSaktgegvdelfeala.----------
00528411   1/2  ----------------------------------------------------------------------
00525021   1/2  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00527351   1/1  ....................vseeealelakelgl..pfietSaktgegvdelfealv------------
00526151   1/1  ................................................lpffetSAktgegve-------
00481541   1/2  ----------------------------------------------------------------------
00463921   1/1  ...............ellglllvsleellelakelgavpvvetSaktgegvdelfeala-----------
00378841   1/1  ....................qvlveearalakelgi.plfetSaktgegvdelfealv------------
00455591   1/1  ..................revskeealelakelgl..pfletSaktgegvdelfeal-------------
00514611   1/1  ...................revseeealelakelgl.pfietSaktgegvdelfe---------------
00531961   1/2  ----------------------------------------------------------------------
00372461   1/1  ---------------------------------------------------------------------P
00514621   1/1  .................................gl.pfietSaktgegvdelfeal--------------
00517041   1/2  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00526801   1/1  ............earevseeealelakel....gl.pfietSaktgegvdelfea---------------
00356411   1/1  .........................................kdpdilllptsaldgeg------------
00492691   1/1  ...................................lllglllvsleeilelakelgavpvvetSakt---
00529141   1/2  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  lllvilelleaglplrsldltleqdlellellletgkpvilvlNKiDlldeeeleelkel----------
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00519521   1/1  ................kglnndleaaleyilskflglnlakdrgipvietSAltgegide----------
00497591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00412341   1/1  ................................elgl.pfvetSAktgegvdelf----------------
00405881   1/1  ----------------------------------------------------------------------
00517841   1/1  kllkeldelgkptilVlnKiDlldegeevldllknlllelgl..................----------
00387311   1/1  elakel............................gl.pfvetSaktgegvdelf----------------
00514501   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00514591   1/1  elakelg.............................lpffetSaktgegveelfeal-------------
00520981   1/1  .............ellglllvsleealelakelga.vpvvetSaktgegvdelfe---------------
00527851   1/2  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00414121   1/1  ............................................................----------
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00525011   1/1  .....................evseeealelakelgl.pfietSAktgegvdelfealael---------
00527641   1/2  ----------------------------------------------------------------------
00450341   1/1  --------------------------------------------------------------------lP
00475471   1/2  ----------------------------------------------------------------------
00401191   1/1  ---------------------------------------------------------------------P
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  ..................lrevsleealelakel....ggvpyfetsaktgegvdelfdelarl------
00440861   1/1  slnkelglkelrrgigyvfqdp------------------------------------------------
00477011   1/1  gkrtivvvtKiDlldkg.....eevldilrglliplgl..........................------
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  ..........................kelkplllflvrdfapvlfisaltgtglde.llealeellgahp
00491101   1/1  --------------------------------------------------------------------pP
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ---------------------------------------------------------------------k
00495771   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  -----lvdkeelekllkellellkelgpgapvvpiSAltgegldelleaiaelleelrlytsglnklira
00492922   2/2  ------------------------------pivpvsaltgegvdelleailellpele------------
00516482   2/2  -----------------------------vpivpvsaltgegidelleaillllgllllelledlla.dl
00526252   2/2  ------------------------------pfietSaktgegvdelfealaellleplllleed------
00529142   2/2  ------------------------------pvievSaktgegvdelfealaelllelkgle---------
00504232   2/2  ------------------------------pivpisaltgegvdelleailellpllell----------
00523462   2/2  ------------------------------pvvevsaktgegvdelleallellpen-------------
00527242   2/2  ------------------------------pvvetSaktgegvdelfealaelllellle----------
00475472   2/2  --------iDlldkeelllilleelaellgapvvpiSAltgegldelleailellleelgleesgldrli
00504822   2/2  ------------------------------pvvevsaktgegvdelfeallellpelalllde-------
00525022   2/2  ------------------------------pvvetSaktgegvdelfealaelllellg-----------
00465512   2/2  ------------------------------pvvevsaktgegvdelleallelleelelllde-------
00481802   2/2  ------------------------------pvvpvsaktgegvdelleallellleklldle--------
00514502   2/2  ------------------------------pvvetSaktgegvdelfealaelllel-------------
00527852   2/2  ------------------------------pvvetSaktgegvdelfealaelllelll.....G-----
00481542   2/2  ------------------------------pvvetSaktgegvdelfealaelllelkp-----------
00511042   2/2  ------------------------------pvvetSaktgegvdelfealvekalk--------------
00517042   2/2  ------------------------------pvietSaktgegvdelfealaelllelllke.lp------
00527642   2/2  ------------------------------pffetSaktgegveelfealvrlilkpkkk----------
00498682   2/2  ------------------------------pvvevsaktgegvdelleallelllelllllllel..ld-
00528412   2/2  ------------------------------pvietSaktgegvdelfealaellpk--------------
00531962   2/2  ------------------------------pvvetSaktgegvdelfealaelllelkllll.srlllll


                         -         *         -         -         -         -         +:350
query           YDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVA
00520541   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00374071   1/1  lpsplle.....----------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00504231   1/2  ----------------------------------------------------------------------
00372481   1/1  rllvld----------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00516481   1/2  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  dellealle-------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00492921   1/2  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00357861   1/1  letllllrvllelllkavlls-------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00471271   1/1  ll--------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00520531   1/1  pdgplqalvfkivyd...pyvgriafvrvysGtlkkgdkvlllrtgkkekvgrllvflglkreevdeala
00481801   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00498681   1/2  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00504481   1/1  pdkpllalvfkvfydp...yrGrvalvrvysGtlkkgdkvllv..gkkvrvgellvflglereevdeala
00424711   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00482521   1/1  pdgplvalvsklvad...pdvgrflafgRvysGtlkkGdkvrvlgpgyspgdeedlkkvrvgrlllfmgr
00520021   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00526251   1/2  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00527241   1/2  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/2  ----------------------------------------------------------------------
00525021   1/2  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00481541   1/2  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00531961   1/2  ----------------------------------------------------------------------
00372461   1/1  erdldkplrllvqdvfkdsgvgtvatgrvesGtlkvgdkvrvlgtlpsvlvgevksllrf.redvdeava
00514621   1/1  ----------------------------------------------------------------------
00517041   1/2  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00529141   1/2  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514501   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00527851   1/2  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00374051   1/1  ----dkplrllvqdvfkisgvgtvvtgrvesGvvkvgdkvlvlpsgktvevksievf....reevdeala
00515531   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00527641   1/2  ----------------------------------------------------------------------
00450341   1/1  erdedkpfrlpvqdvfkisg.gtvaggrvesGvikvgdkvrvlpsg......gkvkslerfkedveeAva
00475471   1/2  ----------------------------------------------------------------------
00401191   1/1  erdldkplrlpvqdvfdingpgtdlddlrGvVvtgrvesGvlkvGdeveilpllllkeggkllllglttk
00396701   1/1  --dldkplralvidvfldsgvgtvatgrvesGtlkvgdkvvvlpsgktgrvksllvf....kedvdeala
00516461   1/1  -rdldkplrlpvqdvfrisgvgtvvtgrvesGvlkvgdevlvlpsgktvrvksievf....deeveeava
00520051   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00504201   1/1  -rdldkplrlpvqdvfkisgvgtvvtgrvesGvikvgdevrvlpsglttkvksievf....kedvdeava
00467111   1/1  e---------------------------------------------------------------------
00491101   1/1  erdldkplrlpvqdvf..kgvgtvvtGrvesGvvkvgdevlvlpsg...kttkvksiemldkveldeava
00465381   1/1  --dldkplrllvqdvfkisgvGtvvtgrvesGvikvgdkvlilpsgkvlkvkvksievf....rkevdea
00362371   1/1  rdldkp.lrllvldvflisgrGtvvtgrvesGvlkvgdkvvllpsgv.iltgkvksiemfk.kdvdeala
00495771   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00379751   1/1  ---vvfPlrlpildvfvingvgtvvvGvrVlsGvlkvgdpvlvlpggkvgevkslern....kedvkear
00414002   2/2  ayellp----------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  lagyall---------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKN
00520541   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00504231   1/2  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00516481   1/2  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00492921   1/2  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00520531   1/1  Gdivavvglkdikvgdtltdaenpvalpllgf--------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00498681   1/2  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00504481   1/1  GdivaivglkdirvGdtltdpenplalellgfd-------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00482521   1/1  ereevdeapaGdivaivglddaiikgdtlt----------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00526251   1/2  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00527241   1/2  ----------------------------------------------------------------------
00520561   1/1  -------------------------------fpePvlfvavepkdpsdlkkllkaLekLaeedpslvvev
00511041   1/2  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/2  ----------------------------------------------------------------------
00525021   1/2  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00481541   1/2  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00531961   1/2  ----------------------------------------------------------------------
00372461   1/1  GdivglllkgvglkdikrGdvltdpe--------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00517041   1/2  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00529141   1/2  ----------------------------------------------------------------------
00482531   1/1  -----------------------------lpfpePvlfvavepkdksdleklleaLeklaeedpsllvev
00507411   1/1  ----------------------------------------------------------------------
00468241   1/1  -------------------------------fpePvlfvavepkdpsdlkkllkaLekLaeedpslvvev
00514721   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514501   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00527851   1/2  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00374051   1/1  GdivglllkgvdlkdirrGdvltdpgnp------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00504521   1/1  -------------------------------vpePvlsvaiepkdssdlgklleaLeklaeedpslrvev
00513761   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00527641   1/2  ----------------------------------------------------------------------
00450341   1/1  GdevglllegiiedikrGdvlla-----------------------------------------------
00475471   1/2  ----------------------------------------------------------------------
00401191   1/1  vksievf....rkeleealagdlvgll-------------------------------------------
00396701   1/1  GdivgillkgvglkdikvGdtltapen-------------------------------------------
00516461   1/1  gdivgltlkgvedisrGdvlvdpdn---------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00504201   1/1  gdnvglllkgvdvedisrGdvlv-----------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00491101   1/1  GdnvgllllgieedisrGdvlvdpg---------------------------------------------
00465381   1/1  vaGdivglllkgvdledir---------------------------------------------------
00362371   1/1  gdivglllkgigledvrrGdvltvpg--------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00379751   1/1  aGdevaialkg.vtvgrdikrgdvlyvlesresadvlilvlredltlgdlpllhillkllaiedp-----
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVF
00520541   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00504231   1/2  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00516481   1/2  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00492921   1/2  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00498681   1/2  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00526251   1/2  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00527241   1/2  ----------------------------------------------------------------------
00520561   1/1  deetgelilgglGelhlevllerLkreygvevilg-----------------------------------
00511041   1/2  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/2  ----------------------------------------------------------------------
00525021   1/2  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00481541   1/2  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00531961   1/2  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00517041   1/2  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00529141   1/2  ----------------------------------------------------------------------
00482531   1/1  detgelilgglGelhlevvlerLereyagvevils-----------------------------------
00507411   1/1  ----------------------------------------------------------------------
00468241   1/1  deetgelilgglGelhlevllerLkreygvevilg-----------------------------------
00514721   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514501   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00527851   1/2  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00504521   1/1  deetgelilsglGelhleillerL.reygvevivs-----------------------------------
00513761   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00527641   1/2  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/2  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LFENDFALRWFADKYPDVELEEKM----------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00504231   1/2  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00516481   1/2  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00492921   1/2  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00465511   1/2  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00481801   1/2  ----------------------------------------------------------------------
00504821   1/2  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00498681   1/2  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00523461   1/2  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00526251   1/2  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00527241   1/2  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00511041   1/2  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/2  ----------------------------------------------------------------------
00525021   1/2  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00481541   1/2  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00531961   1/2  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00517041   1/2  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00529141   1/2  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00514501   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00527851   1/2  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00527641   1/2  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00475471   1/2  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00492922   2/2  ----------------------------------------------------------------------
00516482   2/2  ----------------------------------------------------------------------
00526252   2/2  ----------------------------------------------------------------------
00529142   2/2  ----------------------------------------------------------------------
00504232   2/2  ----------------------------------------------------------------------
00523462   2/2  ----------------------------------------------------------------------
00527242   2/2  ----------------------------------------------------------------------
00475472   2/2  ----------------------------------------------------------------------
00504822   2/2  ----------------------------------------------------------------------
00525022   2/2  ----------------------------------------------------------------------
00465512   2/2  ----------------------------------------------------------------------
00481802   2/2  ----------------------------------------------------------------------
00514502   2/2  ----------------------------------------------------------------------
00527852   2/2  ----------------------------------------------------------------------
00481542   2/2  ----------------------------------------------------------------------
00511042   2/2  ----------------------------------------------------------------------
00517042   2/2  ----------------------------------------------------------------------
00527642   2/2  ----------------------------------------------------------------------
00498682   2/2  ----------------------------------------------------------------------
00528412   2/2  ----------------------------------------------------------------------
00531962   2/2  ----------------------------------------------------------------------