[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56337.1


[Show Plain Result]

## Summary of Sequence Search
   1::269
  87::252  5.5e-24 29.8% 0048077 00480771 1/1   omain                                   
  87::247  1.3e-23 30.3% 0039507 00395071 1/1   omain                                   
  84::247  1.9e-22 30.1% 0045017 00450171 1/1   omain                                   
  86::247  2.8e-20 28.7% 0050197 00501971 1/1   omain                                   
  83::204  9.5e-20 35.8% 0048203 00482031 1/1   omain                                   
  84::207  2.9e-19 30.1% 0039383 00393831 1/1   omain                                   
  81::252    6e-19 26.5% 0044035 00440351 1/1   omain                                   
  85::257  7.6e-19 27.5% 0050875 00508751 1/1   omain                                   
  86::207    1e-16 29.8% 0048425 00484251 1/1   omain                                   
  89::204  1.8e-16 35.1% 0049747 00497471 1/1   omain                                   
   1::269


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLQKELIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
00480771   1/1  ----------------------------------------------------------------------
00395071   1/1  ----------------------------------------------------------------------
00450171   1/1  ----------------------------------------------------------------------
00501971   1/1  ----------------------------------------------------------------------
00482031   1/1  ----------------------------------------------------------------------
00393831   1/1  ----------------------------------------------------------------------
00440351   1/1  ----------------------------------------------------------------------
00508751   1/1  ----------------------------------------------------------------------
00484251   1/1  ----------------------------------------------------------------------
00497471   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
00480771   1/1  ----------------edimlkeleelpealeetlelldeeaiekaaelllnagrifilGrGtsglvAle
00395071   1/1  ----------------leilkeileeliaaleallelldeeaiekaaelllnagrifilGrGtsglvAle
00450171   1/1  -------------dslleilkeileeliealealaealdeeaieeaaellaealknggrilvlGrGgSga
00501971   1/1  ---------------dgylhimlkelkevpealeetlelldeeaieaaaellanagrifilGaGtSgaiA
00482031   1/1  ------------dekggydhfmlkeileqpekvldtlaealealaelld.eilekavelllnagrvviiG
00393831   1/1  -------------dfmlkeikeqpeaiieale.tledlllealekavelllnakrivivGcGtSghaala
00440351   1/1  ----------lekddlldlilkeleelpealeetlelld.eaieaaaelllnagrilvlGaGtsgavAle
00508751   1/1  --------------dlldiilkvleeeiealaetlellddaieeavellaeallnagrilvlGnGgsgav
00484251   1/1  ---------------lGklvteevnelsldldllskgdylhfmlkeileqpealektleli.eeaieaaa
00497471   1/1  ------------------SfmlkeileqlealaetlerldeealeaaaellkkagrvvviGiGgSglaal


                         +         -         -         -         -         *         -:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKFDE
00480771   1/1  aalklkelglpagalsdgdla.....lidegdlviaisqsGetaevlealeeakargakviaiTnnpgsp
00395071   1/1  lalklkelglpagalsdgpl.....alldegdlviaisqsGeteevlealeeakergakviaitnn.gsp
00450171   1/1  vAlelalklketfyihrlglpalalgdshllealhgdlgyeelfarqlaalldegdvviaistsGetpev
00501971   1/1  lelalklkelgypavelshgdlal.....idegdvviaiStSGetaevlealeeakergakviaitgnpg
00482031   1/1  iGgSglaalaaaallesllglpvfvvhdseallgdl.lldpgdlviaiSqSGeTpetlaalela------
00393831   1/1  aayllerllglpvfvlsdseflrydlglltegdlviaiSqSGeTaetlaalelakkrgakviaiTnn---
00440351   1/1  lalklkelgyihaeglpgellhgplalitaiendedydvvflrqldalltkgdvliaiSqSGetpevlea
00508751   1/1  AlelalklletfyiereglpaealhgdlalltaiendegypvvfarqldallgpgDvliaiStsGetaev
00484251   1/1  ellknagriiiiGaGtSghiAleaaakleelggipvellpgealhgdlalltaiendedyedasefr---
00497471   1/1  alaaaleslglpvifvsdsdlgyita.....gdlviaiSkSGeTpetlaalelakelgaktiai------


                         -         -         -         +         -         -         -:280
query           EDCFFDELLLLASTDHLSYGNRISPQFPILLITDCLFSNYLESPERQYYYNQTIIHKEE-----------
00480771   1/1  lakladivllvpageeililslllllqvaptlsptaqlvlld----------------------------
00395071   1/1  lakladlvllvpageealvlastksftaqllvldlLa---------------------------------
00450171   1/1  lealeeakergakviaiTgnpgsplakladvvllvpa---------------------------------
00501971   1/1  splakladivllvpagpealvastaattsqllalill---------------------------------
00482031   1/1  ----------------------------------------------------------------------
00393831   1/1  ----------------------------------------------------------------------
00440351   1/1  leeakergakviaitgnpgsplakladivllvpagpe.....----------------------------
00508751   1/1  lealeaakergakviaitgnpgsplaelldeadvvllvpagee....-----------------------
00484251   1/1  ----------------------------------------------------------------------
00497471   1/1  ----------------------------------------------------------------------