[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56378.1


[Show Plain Result]

## Summary of Sequence Search
   1::210
   4::208  9.5e-58 33.3% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::206  1.2e-57 40.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   2::206  5.1e-56 36.5% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::208  2.1e-54 37.2% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   2::208  2.1e-53 38.4% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::208  4.9e-53 37.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   1::208    1e-51 36.7% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::208  2.7e-51 38.2% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   1::208    1e-50 37.5% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   3::208  2.9e-50 37.7% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   1::208  4.6e-50 37.6% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   2::208  7.1e-50 37.9% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   1::208  9.7e-50 37.3% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   1::208  9.1e-49 35.2% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   7::208  9.6e-49 34.3% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   1::208  2.1e-48 34.1% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   2::208  3.8e-48 37.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   2::208  2.1e-47 36.8% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   1::208  4.2e-47 34.1% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   2::208  4.4e-47 31.8% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   1::208  8.3e-47 36.3% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::208    9e-47 32.3% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::208  5.3e-46 36.1% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   2::208  3.7e-45 30.0% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   8::206  1.6e-44 36.0% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   1::201  5.5e-44 34.4% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   1::208  5.8e-41 37.2% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::208  9.6e-41 32.5% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   1::208  1.5e-40 31.9% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::208  1.6e-40 30.4% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   1::208    2e-40 32.6% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::208  3.6e-40 36.5% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::208  2.9e-39 36.1% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   3::210  5.5e-39 32.2% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  27::181  9.3e-39 44.0% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   1::209    2e-37 33.1% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   1::207  1.5e-36 34.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   1::207  1.9e-36 33.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   1::211  9.9e-36 33.7% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  16::208    1e-34 36.8% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  22::208  2.2e-33 35.2% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  17::192  9.2e-33 40.3% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   1::208    1e-32 32.6% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  12::198  5.2e-32 37.5% 0047841 00478411 1/1   arboxykinase-like                       
  25::193  1.8e-31 35.3% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  21::166  1.3e-30 42.1% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  19::208  2.2e-30 30.3% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   1::123  5.1e-30 34.2% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  11::210  1.1e-29 33.7% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   1::208  2.3e-29 33.5% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::208  5.2e-29 33.0% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   1::203  6.4e-29 27.3% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  26::187  7.6e-29 39.0% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  13::183  2.1e-28 38.1% 0047552 00475521 1/1   arboxykinase-like                       
  14::208  2.9e-28 38.8% 0053253 00532531 1/1   arboxykinase-like                       
   2::202  4.4e-28 32.3% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  25::208  1.9e-27 35.2% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  25::209  4.8e-27 29.9% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
   2::209  6.2e-27 31.4% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  25::199  3.1e-26 35.1% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  12::194    4e-26 29.8% 0047844 00478441 1/1   arboxykinase-like                       
  27::170  6.8e-26 38.7% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  22::196  8.9e-26 34.4% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   4::192  9.3e-26 36.2% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  16::208  4.3e-25 34.2% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  22::192  1.5e-24 36.0% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  28::208    1e-23 34.0% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  27::207  4.7e-23 32.4% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  26::184  6.3e-23 37.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   8::209  1.6e-22 29.0% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   5::192  2.5e-22 30.1% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
   1::207  3.2e-22 29.7% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   2::210  5.2e-22 29.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  26::189  1.7e-21 36.5% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   3::210  2.5e-21 31.9% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  26::212  4.2e-21 29.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   5::208  5.3e-21 22.6% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  27::193  7.7e-20 31.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  24::210  1.3e-19 26.3% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   2::208  1.4e-19 29.8% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  27::209  6.9e-19 30.5% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  28::211  8.6e-18 23.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  21::201  9.4e-18 22.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  28::211  1.2e-17 25.6% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  19::212  1.6e-17 27.5% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  25::206  1.8e-17 31.8% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  18::209  6.7e-17 25.9% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  24::206  7.3e-17 25.0% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  11::209  9.8e-17 30.4% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  26::196  9.8e-17 29.0% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  27::208  3.1e-16 30.9% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  11::209    4e-16 29.3% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  11::211  4.3e-16 31.1% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  22::212  4.5e-16 28.2% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  20::188  1.1e-15 31.1% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   2::210  1.5e-15 25.3% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  24::193  4.8e-15 22.2% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  20::195  6.7e-14 33.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
   5::209  1.1e-13 28.2% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  11::199  2.7e-13 26.7% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  27::208  6.8e-13 26.8% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   5::195  6.9e-13 26.0% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  21::190  1.8e-12 34.6% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  21::207  2.1e-12 24.0% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  11::201    3e-12 27.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   2::194  4.4e-12 31.5% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  14::211  6.1e-12 33.1% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  21::208  1.8e-11 24.1% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   5::194  2.4e-11 26.6% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   4::195  1.1e-10 28.6% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  22::196  1.1e-10 27.2% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  27::210  1.1e-10 22.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  27::166  2.5e-10 31.9% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  28::162  5.1e-10 23.7% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  21::206  1.1e-09 26.7% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   2::209  1.3e-09 25.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  19::194  1.6e-09 33.0% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  19::192    2e-09 22.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  26::163  2.5e-09 24.8% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  11::194  3.2e-09 26.6% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  14::194  3.4e-09 27.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  22::196  3.7e-09 26.6% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  22::168  3.9e-09 26.9% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  15::192  7.6e-09 24.0% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  20::161  1.6e-08 26.6% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   5::199  1.7e-08 25.0% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  27::192  1.1e-07 21.9% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  26::195  2.1e-07 26.4% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  11::194  2.7e-07 25.9% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  22::196  3.2e-07 24.4% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  27::210  5.5e-07 25.6% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  20::177  8.8e-07 27.8% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  11::47   2.5e-06 37.8% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  23::162  6.3e-06 31.2% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  27::201  6.5e-06 24.2% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
   2::67     9e-06 32.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
   1::47     1e-05 40.4% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  24::208  2.3e-05 24.4% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
   3::58   2.6e-05 30.9% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
  27::204  2.6e-05 22.2% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  22::208  4.8e-05 24.4% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
   4::197  6.2e-05 23.4% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
  27::55   0.00013 48.3% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  22::192  0.00014 22.1% 0046315 00463151 1/1   p containing nucleoside triphosphate hy 
  27::161  0.00019 28.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  27::75   0.00021 30.6% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
   5::194  0.00024 24.8% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  27::89   0.00035 31.0% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  12::47   0.00037 36.1% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  27::85   0.00041 36.7% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  26::53   0.00044 35.7% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  27::196  0.00046 22.9% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  27::64   0.00054 38.9% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  26::206   0.0009 29.0% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
   1::210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYRGKDLANYKSS
00390411   1/1  ---MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrga
00509431   1/1  Mlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdli
00367901   1/1  -lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilk
00379581   1/1  lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00422801   1/1  -llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkll
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00475891   1/1  lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00404101   1/1  --elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllptsGeilldgldltalsla
00436071   1/1  pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla..
00425571   1/1  -lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl
00500441   1/1  lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdi
00361211   1/1  plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlld
00466931   1/1  ------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdila
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00466971   1/1  llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvG
00530591   1/1  llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkp
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeival
00475991   1/1  lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGe
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00485451   1/1  -------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvl
00436511   1/1  ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikkGe
00469451   1/1  allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00495371   1/1  esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp..evlvdg
00424961   1/1  lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglldpd
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00496111   1/1  --elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsae
00381441   1/1  --------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlge
00422141   1/1  dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlieliflde
00367481   1/1  yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpas
00379601   1/1  llelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel....
00437981   1/1  lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkd
00503371   1/1  ---------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsg
00485931   1/1  ---------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.....
00448931   1/1  ----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla.
00500611   1/1  pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00478411   1/1  -----------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl....Gtilldg.dlvrlglk
00457311   1/1  ------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlykl
00480471   1/1  --------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeill
00468601   1/1  ------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaa
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00462761   1/1  ----------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr.
00495031   1/1  lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggk
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00464791   1/1  lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGer
00515531   1/1  -------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgv
00475521   1/1  ------------evlalhgvsldve.gevvllvGpsGsGKStllralag....sGeilvdg.dlv...dl
00532531   1/1  -------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinlegg
00368501   1/1  -kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlara
00426051   1/1  ------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlgg
00477971   1/1  ------------------------hkgelvvlvGPsGaGKsTLlnaLlgllptsgvisvsgttr...ppr
00379961   1/1  -yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdll
00414121   1/1  ------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidg
00478441   1/1  -----------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl....Gailvdd.dlvll...
00475381   1/1  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavl
00487021   1/1  ---------------------rm.....kiivltGpsGsGKsTlarlLaell...gvvvidtddllra..
00356411   1/1  ---lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkl
00475371   1/1  ---------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi.....
00451571   1/1  ---------------------MsikkgeiiaivGppGsGKsTlaklLakll...glivldgddl......
00512891   1/1  ---------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....
00533501   1/1  --------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp
00515511   1/1  -------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgv
00379261   1/1  -------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKT
00477011   1/1  ----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrl
00434401   1/1  M.....lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpa
00437941   1/1  -lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvl
00484101   1/1  -------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldig.rld
00503741   1/1  --fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLakll
00493431   1/1  -------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpg
00489571   1/1  ----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..............
00496571   1/1  --------------------------GkgelivllGpsGsGKsTlarlLagll..ggsvldtgepirgep
00468951   1/1  -----------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgika
00404191   1/1  -vtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa...
00498811   1/1  --------------------------kPgkiigltGpsGsGKsTlarlLael....gvividgddlt.re
00513761   1/1  ---------------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlp
00470731   1/1  --------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlar
00480441   1/1  ---------------------------rlivllGpsGaGKsTlaklLaellp..glivisvgdttr.epr
00490731   1/1  ------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp.....
00464411   1/1  ------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgep
00368571   1/1  -----------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgelgrhl
00498531   1/1  -----------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDa
00444381   1/1  ----------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrll
00532471   1/1  -------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgel
00499191   1/1  --------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..........
00406781   1/1  ----------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase........
00392701   1/1  ----------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd........
00489631   1/1  ---------------------M...kgklillvGppGsGKtTlaraLaellglpf.iridgddllrellg
00508671   1/1  -------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvv
00439861   1/1  -kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlakn.......ggkvlyisl
00510561   1/1  -----------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDl
00437901   1/1  -------------------lslgirpgrillLyGppGvGKTtlakalakel.........gapvieidas
00386741   1/1  ----klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrld
00527261   1/1  ----------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel.gkpv
00405881   1/1  --------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvve
00437921   1/1  ----lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsggg
00432181   1/1  --------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvv
00511381   1/1  --------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlg
00394721   1/1  ----------vgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrl
00420941   1/1  -lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel....
00513251   1/1  -------------iellsdlslsipspevvllvGppGsGKstlakklaell...gfilidaddlr.....
00499331   1/1  --------------------PslslkkgklivltGppGsGKtTlakaLaerl...glpfidtddllrepv
00367291   1/1  ----vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel.gap
00482661   1/1  ---kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnr
00472911   1/1  ---------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglagegg
00477721   1/1  --------------------------kpklilltGppGsGKttlaraLaeel...glpfidtddll....
00515351   1/1  --------------------------mngklivltGppGsGKtTlaraLaerl...glpvistddllrea
00469161   1/1  ---------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtpl
00533151   1/1  --------------------MsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllrelv
00430121   1/1  -iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtl
00521551   1/1  ------------------flslglrpgkgvlLvGppGtGKTtlaralagllga.................
00480251   1/1  ------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaa......laergkkvl.lid
00461621   1/1  -------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevverg
00473941   1/1  ----------vgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga..........
00402371   1/1  -------------eallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrlda
00487061   1/1  ---------------------ldM..kkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdyw
00478391   1/1  ---------------------msikkgklilltGppGsGKtTlaralaerl...glpvidgddllrelvg
00410531   1/1  --------------gelknlslelkkglkillvGlngvGKTtllkrlaggefv.dygptigvnfktvevd
00517691   1/1  -------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg........
00416171   1/1  ----diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr..............sgv
00476071   1/1  --------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll..
00519581   1/1  -------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaellfgdv
00418301   1/1  ----------iGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr.
00489391   1/1  ---------------------lsikkgklivltGppGsGKtTlakaLaerl...glpvistddllreavp
00478081   1/1  --------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrrea
00409841   1/1  -------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv.
00410321   1/1  ----------yggllllkdlslelkkglkilllGlngaGKTTllnrl-----------------------
00401211   1/1  ----------------------elkrglnvgivGhvgaGKSTLlnaLlgll...................
00496061   1/1  --------------------------gklivltGppGsGKtTlaklLaerlglpvistddllre......
00495771   1/1  -igvdvvlvsakkgall.dilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrh---
00471271   1/1  prailelesliksllekllellkrlslklkkglkvalvGrpgvGKSt-----------------------
00482551   1/1  -----------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaana
00470231   1/1  --elaellsllierlllrdlllelkllkv.llvGdpnvGKStLlnrlkivsdpgtTig------------
00509891   1/1  --------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld.
00480501   1/1  ---------------------M....gklillvGppGsGKtTlaralaellg..gvvvidgddlrralvg
00497571   1/1  ---aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdf
00478131   1/1  --------------------------kgkvivltGppGsGKtTlarlLaellkpl---------------
00463151   1/1  ---------------------M.....kiIgltGpiGsGKsTvaklLaekl....glpvidtgDilrkal
00457851   1/1  --------------------------PkgklivltGppGsGKtTlakaLaerl...........glpvis
00482721   1/1  --------------------------kgkiigltGpsGsGKsTlarlLaelglpvidtddlyrelvaggt
00474201   1/1  ----deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlarala
00491901   1/1  --------------------------lmkgkiilltGppGsGKttlakaLaeelglpfidtddllrea..
00378621   1/1  -----------glklllrrlslllkkglkvllvGlpgvGKstllnrl-----------------------
00516041   1/1  --------------------------mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl.
00493171   1/1  -------------------------mgklivllGpsGaGKsTlaklLaeklgl-----------------
00493981   1/1  --------------------------kpklilltGppGsGKttlaraLaeel...glpfidaddllr...
00512061   1/1  --------------------------kkkkgklivltGppGsGKtTlakaLaerlg..glvvid------
00403151   1/1  -------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvktve


                         -         -         *         -         -         -         -:140
query           DFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQVGLAYLDLDKRIFELSGGES
00390411   1/1  dkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgig
00509431   1/1  flgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr.ligyv
00367901   1/1  gllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvpqdpalfpq
00379581   1/1  lslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgl
00422801   1/1  agllkptsGeilldgldilalslae.lrrrigyvfqdpalfp.ltvrenlalglllallllglskaeara
00378981   1/1  slaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellellgldd.lldrlvge
00475891   1/1  lglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalralllllllgl.etlldrlvse
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellgldd.lldrlvg
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00404101   1/1  el.rrgigyvfqdpalfpgltvrenlalgll.....kaeararalellellgld.elldrlvgeLSgGqr
00436071   1/1  ....lrrgigyvfqdpalfpgltvlenlalgllllgll..ealaralellellglgdl..drlvseLSgG
00425571   1/1  ...lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellgldd.lldrlvgeLSgGq
00500441   1/1  ldlsl...lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgl.edlldrlvse
00361211   1/1  gleisalslaerlragigyvfqdlalfpeltvlenlalg.............rarellerlglail..dr
00466931   1/1  lspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldll
00482201   1/1  slkel..rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlps
00482261   1/1  slael..rgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgl.etlldrl
00502741   1/1  slael..rgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellellgled.lldrlpseLSg
00466971   1/1  glslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlld
00490801   1/1  pnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll............
00530591   1/1  tsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralll
00510251   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00475991   1/1  illdgkdildlslael..rgigyvfqqdallpsltvlenlllglllagellllllaakeaalrallllll
00458601   1/1  spqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgl
00485451   1/1  vigldifrlsa.relrkrig.vfqdpallphltvpenldlglll......eilervlellelvgldvvll
00436511   1/1  rvglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpalpa
00469451   1/1  lylsleesleqlrrrigyvfqdpalfp.........................aeellelvgle.dlldrl
00495371   1/1  ldltglspa...rggiglvfqteallppltvrenlealgldlrglld...rerviellelvglee.lldr
00424961   1/1  sgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfrdegadvllladsll
00498251   1/1  Lalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl..............
00488521   1/1  ...............ggkvlyvdqeeslfp.ltvlenlalg...........gedveellerlgl..dll
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre...lrrrigyvfqdpalfpeltvlenlal
00372301   1/1  vdgedlr...........igyvfq..................................llervgled.ll
00496111   1/1  elrerr.rrigyvfqepalfpeltvlenlalgll...........................drlpgeldl
00381441   1/1  vdgvdltfls.....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeelle
00422141   1/1  eellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlgl
00367481   1/1  ggilvpgedalll.............................................rvdeiltrvgls
00379601   1/1  ...lrnkigyvfQdpvlfp.ltvren............................................
00437981   1/1  i.........rrgiglvfqliglfphltvlelvalglggilveevrellkel..................
00503371   1/1  eirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllgl.gdeliirrrilrdgrseyllngl
00485931   1/1  .....rrigavpqlpvlfprltvlenlalg.......gadlaeraeellellglegfdvvliDtagrgrr
00448931   1/1  ...areqlgivfqdpgl....tvlenlalg.........eleararellellgledydvvliDtagrlrl
00500611   1/1  lggkvlyisleeslrrrrigmvfqelgldpdltv.................arerviellelvglle.ll
00478411   1/1  d....gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddl.ldrypdelsggq
00457311   1/1  sreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk........llepvglp.evldryph
00480471   1/1  dgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvil
00468601   1/1  ae..rlgigavpqdvplfpsltvldnlalar..dlleaakaagydvvlidtaglld..ldrlvgelsggq
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfq-----------------
00462761   1/1  ......lglliglvfqdpdllpfltvlenvllpllaaglivivdgtlllvglrealrkll......glls
00495031   1/1  vlyiglelt..lsperlrlraqsl.....................gldldellerllvidllelvglle.
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtD..ifylpaeqlkrigllf
00464791   1/1  vglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf..............
00515531   1/1  klqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpi
00475521   1/1  eplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp..sggq
00532531   1/1  fyakaigllrrkigyvfq...lfpfltvlenvalgld..glvdeedleraenllalvgl.eeipnrypse
00368501   1/1  lakllga.pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllvselig
00426051   1/1  esglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellle.
00477971   1/1  pgevdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveellea.gldvl.ldidpqglsggqk
00379961   1/1  dpkdlrellragiplvflnfaalpasllesel......................................
00414121   1/1  qll.edlgvlavrlgigyvpqtlglfpaltvlellalall......................lredpdli
00478441   1/1  elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld....drypyelsgge
00475381   1/1  srdllgllreglirigyvfqdyalfprltvlenvllgll.........................llgglv
00487021   1/1  ........gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl...lldrippals
00356411   1/1  tlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpiil
00475371   1/1  ....................................rrpsarellgllgellgldvl.vgarggdlsggl
00451571   1/1  ..lreaiglvtqdgelllelide........gilvpdeiviellrealeeldadgvildgfprllgqael
00512891   1/1  .rsarrgigyvfq........tveellgllaelvgle.............vrgeleellktlikelsgge
00533501   1/1  .....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydg
00515511   1/1  klqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpi
00379261   1/1  tlaralAkllgapfvevdaselteggyvgedlekr.irelfqearllvfltvlenirldaseylekrvvs
00477011   1/1  setpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlv
00434401   1/1  aelllreglgidfqlpdal.....................drellreevlellglgev.vivdvydlsgg
00437941   1/1  gidaselld.............................................................
00484101   1/1  ldellg.igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalpli
00503741   1/1  agllkpkfgeillfgkvvyvnvselldlkellrll...................................
00493431   1/1  ev...rgigyvfqsgalfphlivagnllegaevhgllygtskerveealekgllvlldr.....dlsggq
00489571   1/1  ......................................................................
00496571   1/1  lgelir...glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlay.gfprtlsg
00468951   1/1  LDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid...teesldqlrarrlgldldd
00404191   1/1  ...............................................................delvskl
00498811   1/1  lvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvvile.g
00513761   1/1  eqlgidirdlidletvmelglgpngalvfaleellttld......illealelleedydyiliDtpGgle
00470731   1/1  alakelgagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidall.rkgpdvildgagr
00480441   1/1  egevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glgvl.ldgfprglsqaqa
00490731   1/1  ....................................yrpaadellgvlaeelgldvl.lgarggdlsggl
00464411   1/1  lge....ligevfqdgilfpdltvlenvalgrygll.glikealaegvivildrvglsdla...ypgfls
00368571   1/1  livGptGsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgd....grsvrlnplalid
00498531   1/1  llgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql...rarrlgldldelll
00444381   1/1  ellgarpgenvlLvGppGtGKTtlakalakllgv.pfiridgselte...kelvGe..............
00532471   1/1  ggaalldivde..grliglvfqdldllpllevlellaa.....rleellerippa...............
00499191   1/1  ....gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprllsg
00406781   1/1  ........................................................llgkyvgelsgglr
00392701   1/1  ........................................................llgkyvgelsgglr
00489631   1/1  ellgrgigfgfqqgdlledatvlenlalllldeidka....................ledggvvlldgfd
00508671   1/1  lldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalglelrdelrellkeaglpl
00439861   1/1  eesreqlleraerlgldleellllgllsiliad............................plglsgeel
00510561   1/1  llgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql...rarrlgldldrlll
00437901   1/1  elrd..................................................vddlsgyvgelsggek
00386741   1/1  a.....................................................................
00527261   1/1  iyidlselsskgyvdleellrelaeelgellellkkllkklsellgl.......................
00405881   1/1  ldd...................grqlvlvDtpGlielaslgeglvrqalealerad.villvvdasdpll
00437921   1/1  vdvi.eldasdlrgvddlreligevlqalglllgg...................................
00432181   1/1  eldgrkl...........................................................vliD
00511381   1/1  ielvvsriglvleavglffaldllelll..........................................
00394721   1/1  dlsellsv.....................................................sdlvgeleg
00420941   1/1  .....gapfiridgse......................................................
00513251   1/1  ...................................................................gqk
00499331   1/1  ig.agtdigevfqdlllaggllvddev.................rrlllealdell.laggkvvildgfp
00367291   1/1  firvdaselle.k.........................................................
00482661   1/1  qkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlk
00472911   1/1  kpl.........................................................gllfedalea
00477721   1/1  relvgegielilelfd.........................rarfrkllielldellaaggvvldlgrtl
00515351   1/1  vpg..gtdigelfqdyllfpfltvdeni..........rglllealeellaagkvvild......glsgg
00469161   1/1  gelirelllegfqdlilvpdllvlellaanragl.relikellaagkgvildrfplsrl...ayqlsgge
00533151   1/1  ..pggldigevfqda.leaglllfddefrglller..................leellargpvvildgfp
00430121   1/1  akalagllfpsgvpfirinlseltekllvselighppgyv..............................
00521551   1/1  ...................................................pfvrlsaselvgkyvgele
00480251   1/1  lDpyrpsapeqlgilgellgvpvvgvltgldlagalrealell...........llegydvvliDtaggl
00461621   1/1  telgklikdyfdpgalvpd.llirlllerllfldegggflldgfprtleqaeals...........kpav
00473941   1/1  ...............................................pfielsasdllg.........es
00402371   1/1  selle.....................................................fgkyvgafeggl
00487061   1/1  aavgggdllr....lirelllrlgfgepdafdnellgellealleg........................
00478391   1/1  eggrlgrd.lfdedrllfrellideidl..........................................
00410531   1/1  g...vkl.....................................................viwDtaGqer
00517691   1/1  ........................................gtlllllgllsfllalvldslplerergit
00416171   1/1  pfvrvncsalte.......................................dlleselfghekgafggge
00476071   1/1  ..........................ggpllerirellgegyllfdealdrellaallfglelegalldg
00519581   1/1  gglvvdli.............................................................d
00418301   1/1  ...................................................................pfi
00489391   1/1  g..gtdlgelfqdlllegellfideiaelllealae..................................
00478081   1/1  irelllgldlleilf....................................................egl
00409841   1/1  ......................................................................
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  .........................................................ldtlkgelergit
00496061   1/1  .evepggtdlgeifqalllagel.lfddevlgll.............rerldelielllaggvvildgfp
00495771   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00482551   1/1  alplelgklggkvlyistee..afsperlreralsl.....................gldleelldrllv
00470231   1/1  ----------------------------------------------------------------------
00509891   1/1  ...............................ldeplgvdrerlrrvgelalllagggl.calvaddlaga
00480501   1/1  gl...............................................idgllilfledeaals.elvl
00497571   1/1  ddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfirv
00478131   1/1  ----------------------------------------------------------------------
00463151   1/1  yratglgalakiisliellilfgelvpddlvldrlvlerlvf........................sdpe
00457851   1/1  tddllreavpggtrlgeviqdlfllggllffdeldel..........lkerieellaag.gvild..gfp
00482721   1/1  plger-----------------------------------------------------------------
00474201   1/1  nelprslpglpfvr.vnasdltdvglleellgkllgaat...............................
00491901   1/1  ...klggelaeliedlfvp---------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00516041   1/1  ......lrgeelgri-------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00493981   1/1  .elvgegigllfelaeraeflillideidkllee....................................
00512061   1/1  ----------------------------------------------------------------------
00403151   1/1  idgkkl...............................vkltlwDtaGqerfrslre....lyyrgadgvl


                         +         -         -         -         -         *         -:210
query           QRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSLRDDNRLIIIATHNPAIWEMADEVFTMDHLK
00390411   1/1  lvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllellegl--
00509431   1/1  pqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleli----
00367901   1/1  ltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraee----
00379581   1/1  dt.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvt--
00422801   1/1  ralellellplgldt.lldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellr--
00378981   1/1  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla--
00475891   1/1  LSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrlad--
00420701   1/1  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrl--
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpn--
00404101   1/1  qrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrla--
00436071   1/1  qrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv--
00425571   1/1  rqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilv--
00500441   1/1  LSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrla--
00361211   1/1  lpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilv--
00466931   1/1  lllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvs--
00482201   1/1  eLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsearlad--
00482261   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseall--
00502741   1/1  GqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladril--
00466971   1/1  rlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldea--
00490801   1/1  lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetra--
00530591   1/1  llllgl.etlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gl--
00510251   1/1  ..lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpet--
00475991   1/1  lgl.etlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvl--
00458601   1/1  edlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtH--
00485451   1/1  dtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvt----
00436511   1/1  llrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlft---------
00469451   1/1  pgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH.--
00495371   1/1  lprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdlee--
00424961   1/1  rlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDept--
00498251   1/1  ..................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellr--
00488521   1/1  drlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlak--
00468691   1/1  gallag................lgl.aeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgld--
00372301   1/1  drlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdle--
00496111   1/1  Sgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdleeaed
00381441   1/1  llgldadlviilpasleellerldrrggelsggqkqRvala-----------------------------
00422141   1/1  sygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.............i-
00367481   1/1  dl.ldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlv---
00379601   1/1  .....laralrqdPdilllDEptsalda...e.llqallt....ghtvvlvthhlntaldladriiv---
00437981   1/1  .lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellpalls
00503371   1/1  gvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleel--
00485931   1/1  vgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvthddgta--
00448931   1/1  pselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel.------------------
00500611   1/1  drlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgvtvllvth--
00478411   1/1  rqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalellllde------------
00457311   1/1  elsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldad-----------------
00480471   1/1  llnkidllddrllrraeaeerieell--------------------------------------------
00468601   1/1  kqrvaiarala.apevllldeptsgldalae..llelleel...gltvlvvtKlDgtakgghdlslal--
00387201   1/1  ----------------------------------------------------------------------
00462761   1/1  gGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdlsieevad
00495031   1/1  lldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvth--
00371631   1/1  q.kglpealdveellellldlke......................gledilvpvlsggqkqrlalara--
00464791   1/1  ................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvlll-------
00515531   1/1  llvlnKiDlleakeraeellellgl.gdlldklpselsgGqkqrval-----------------------
00475521   1/1  qqeilrvaiallilpvllgralallpelllldeptsaldpdlv---------------------------
00532531   1/1  lsgGqqqrv...........illldEPtsgLdpvsr..........................leladr--
00368501   1/1  appgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelr--------
00426051   1/1  gldtlag.gggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeelle--
00477971   1/1  qrlalaralilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleealelldrilvl.l-
00379961   1/1  lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpa-
00414121   1/1  lid.sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlglt-----------
00478441   1/1  rqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvdrl----------------
00475381   1/1  vildggvrqrlalarallldpdvllldepl----------------------------------------
00487021   1/1  gGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpd--------------
00356411   1/1  vlNKiDlleekive.ellellgleykgd.rdpeelsggqkqrvalaralakd------------------
00475371   1/1  rqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadr--
00451571   1/1  llsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkk------------------
00512891   1/1  kqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallr--
00533501   1/1  fprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylel---
00515511   1/1  llvlnKiDlleaklvllllvgl.fdlldglpselsggqkqrval--------------------------
00379261   1/1  rligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgellle-
00477011   1/1  DtPGlgsva...vvdqlsggqkqrvalarallknpdtlillvedand..ldt------------------
00434401   1/1  erqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlkrl---
00437941   1/1  .pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeldpa
00484101   1/1  lelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlll---------------------
00503741   1/1  .....lealglpppyq......lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlr
00493431   1/1  qlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeel
00489571   1/1  lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvthldeaer.aDrvavl--
00496571   1/1  lgqrqrvalarallkpdlvifldeppteeldeRlrkrlrlgdteevlehrler-----------------
00468951   1/1  llllpaltveellala................................erllsggkpqlvviDsltalrp
00404191   1/1  sgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqa--
00498811   1/1  plllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividndlslee-
00513761   1/1  .lrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseegle
00470731   1/1  tpeqlealldllee.......lgrpvvviilttnrevlldral.rRpgrllldep..eldp---------
00480441   1/1  lrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleealelll
00490731   1/1  rqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvll
00464411   1/1  ggeqqrvaiarallpkpdlvllldepteeldeRllkRgrllekleyikkrlehylelaepykddvv----
00368571   1/1  deedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselglrdladrlekl-
00498531   1/1  lpaltveellala................................erllsggkpdlvviDsltala----
00444381   1/1  .........................................segailsggfkqrvgia..lladpgilf-
00532471   1/1  ....lsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslll--------------
00499191   1/1  gqrqrvaia.....dpdvlildgptllldpe...........................lrpladlvif--
00406781   1/1  qrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndle-
00392701   1/1  qr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpee
00489631   1/1  rsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvivtddl..
00508671   1/1  l.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdl----------------------
00439861   1/1  lrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelildalaggga
00510561   1/1  ldaltv................................eellalaerllsggk-----------------
00437901   1/1  lrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliil---------------
00386741   1/1  ...selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglll-
00527261   1/1  .silglelilglsggdleelleelaellkklgkpvililDEiqslldvsske.lleaLl-----------
00405881   1/1  dqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee.....lggtvvlvSahdg--
00437921   1/1  ..........................kpdvlllDEi.drldpdaqnallklleel---------------
00432181   1/1  tpGleefasggekqrvalalallreadvlllvvdadeptsfldle....l--------------------
00511381   1/1  ...........qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfegsll---
00394721   1/1  glrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattnrp---------
00420941   1/1  .llgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvr----------------
00513251   1/1  qrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvllldeg
00499331   1/1  ggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdliely--
00367291   1/1  .......lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpev----------------
00482661   1/1  lflkgpellldl..glpkgrgllLyGPpGtGKTtlakalanel..ggpvi.....---------------
00472911   1/1  gfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlviflda--------------
00477721   1/1  llrralrellreldlvvfldapleelleRllkRggrfdllielplleelkeilrellplykeladlvidt
00515351   1/1  llqrvallrallrpdlvifldaplee--------------------------------------------
00469161   1/1  rqrlaidlegalllerllldep------------------------------------------------
00533151   1/1  ggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylklyerlie----
00430121   1/1  ..........................GedelgvlfeaarkappsvlllDEidkl.....dpdvlnaLlq-
00521551   1/1  gglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrll----------------
00480251   1/1  qrglllalaladlllvllldepllvldatagtellelakgllealgldgvvl------------------
00461621   1/1  lsggrkqrlalaralavdpe.li-----------------------------------------------
00473941   1/1  dlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilgg----------------
00402371   1/1  rqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nv----------------
00487061   1/1  ...gki.vlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggld--------------
00478391   1/1  ........llakgkvvildgtnlseald------------------------------------------
00410531   1/1  frsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvg------------------
00517691   1/1  idvalarllldgrkilllDtP-------------------------------------------------
00416171   1/1  kq.rlgllrladggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggivlpadv-----------
00476071   1/1  lvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldappevl------------------
00519581   1/1  leaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfeli---------------
00418301   1/1  rvdaselteaelvGyesgarlrelfaragigllaladpgvlflDEidkllparg----------------
00489391   1/1  ..........aegkvvildgtg..ldieqrealrelllel.prpdlvifldadpee--------------
00478081   1/1  llsdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevlleRl
00409841   1/1  ........vlldgrdllllDtPGlidfaseptnlldl---------------------------------
00410321   1/1  ----------------------------------------------------------------------
00401211   1/1  ikigaasllldklaivsdtpgt------------------------------------------------
00496061   1/1  ldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevlekrlery---------
00495771   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00482551   1/1  idatdlldllel.lerlrrllsegkvdlvviDslallarael.ldepllgldarelrellrlLkrlak--
00470231   1/1  ----------------------------------------------------------------------
00509891   1/1  leel.laralaggpdviliEgagllplpliellrdlldlvvlvvldgivllvdaidrleaadll------
00480501   1/1  evllealegggnpdvvildgt..nlleedrellrellkrlgrpdlvifldapleellerllkrgredl--
00497571   1/1  n........................................................-------------
00478131   1/1  ----------------------------------------------------------------------
00463151   1/1  evildgphplvqaeild.eiaralsvvldllvldeplvglqrrl.agrrgiv------------------
00457851   1/1  ldlegaealreallragplpd-------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00474201   1/1  ...............................fllakpgvlflDEidkl.dpdvq----------------
00491901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00493981   1/1  .............gkvvildgtplllea.lrellreld........lvvfldappe--------------
00512061   1/1  ----------------------------------------------------------------------
00403151   1/1  lvydvtdresfenvlswleelrellgllllegvpillvgnKlDlptne.rdvsleealelalelgl----