[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56413.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
  58::237  6.9e-43 36.8% 0050199 00501991 1/1   ouridine synthase                       
  44::239  4.7e-41 32.5% 0042443 00424431 1/1   ouridine synthase                       
  60::237  4.4e-40 37.8% 0047872 00478721 1/1   ouridine synthase                       
  53::227  1.4e-36 33.7% 0050102 00501021 1/1   ouridine synthase                       
  32::231  1.8e-34 31.0% 0051811 00518111 1/1   ouridine synthase                       
  57::241  8.5e-29 32.4% 0043606 00436061 1/1   ouridine synthase                       
  58::242  1.2e-25 26.4% 0043107 00431071 1/1   ouridine synthase                       
  57::238    4e-23 28.7% 0039976 00399761 1/1   ouridine synthase                       
  19::224  2.1e-18 24.5% 0052542 00525421 1/1   ouridine synthase                       
   2::86   1.5e-15 33.3% 0035794 00357941 1/1   -L RNA-binding motif                    
   1::102    5e-14 33.0% 0037616 00376161 1/1   -L RNA-binding motif                    
   1::60   3.1e-13 49.2% 0047871 00478711 1/1   -L RNA-binding motif                    
   1::68   1.7e-11 34.3% 0039540 00395401 1/1   -L RNA-binding motif                    
   1::58     7e-11 45.6% 0044787 00447871 1/1   -L RNA-binding motif                    
   1::59   2.6e-05 27.6% 0042206 00422061 1/1   -L RNA-binding motif                    
   1::42   0.00032 40.5% 0047115 00471151 1/1   -L RNA-binding motif                    
   1::42   0.00095 36.6% 0036496 00364961 1/1   -L RNA-binding motif                    
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
00501991   1/1  ---------------------------------------------------------edddllvlnKPag
00424431   1/1  -------------------------------------------eellvevlgldilyededllvlnKPag
00478721   1/1  -----------------------------------------------------------ddllvlnKPag
00501021   1/1  ----------------------------------------------------ldilyedddllvlnKPag
00518111   1/1  -------------------------------glvlelglkvdpeldvlvlgrplklllldgvllldKPag
00436061   1/1  --------------------------------------------------------yeddgllvldKPag
00431071   1/1  ---------------------------------------------------------llnglllldKPsg
00399761   1/1  --------------------------------------------------------yllngillldKPag
00525421   1/1  ------------------dllllklllkvlgkllvlvllltplglgvlpedrplkvlyedgllvldKPag
00357941   1/1  -kklseyglqlrekqklrffYgltekqllnyfkealklkgvtglnllqllerRLDkvlarlglaksrrqA
00376161   1/1  rRLdkvlfrlgfasSrrqArqlInhghVlVNgkvvdipsylvkpg.Dvitvrgksrllllilealelyll
00478711   1/1  lRLdkflaelgllsRseakklikagrVtvngkvvtkpslkvkpg.dvitvdgellellel----------
00395401   1/1  alfhgglaelqaeelfellddlpevelllleirLdklLvraglakSrreArrliqagaVlvngekvtd--
00447871   1/1  gmRLdkflarlglasrseakklieagrVlvngkvvtkpsykvkpg.dvievdgkllep------------
00422061   1/1  rllkgelpddllevelsdeyirLdqlLklaglaesggeAkrliaeggVkvdGevvtrrg-----------
00471151   1/1  irldklLvraglakSrsearrlikqggvrvngevvtdpglkv----------------------------
00364961   1/1  ellemRLDkvlyragfaktrslArqlvehGhvlvnGkrvk.P----------------------------


                         -         -         *         -         -         -         -:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
00501991   1/1  llvhpgdglrgtlldlllallg.lrlylvhRLDkdTsGllllakdgelarrllfpkrkveKtYlalvlgv
00424431   1/1  llvhpgdgllrgtlldlllallgdlggllrlypvhRLDkdTsGllllakdgeaarrlseqfpkreveKtY
00478721   1/1  llvhpgdglgrtlldlllall.lprlypvhRLDrdTsGllllakdgeaarrllfpkrkveKtYlalvagv
00501021   1/1  llvhpgdgllrgtlldlllallglprlypvhRLDrdTsGllllakdgeaarrlselfperkveKtYlAlv
00518111   1/1  vtShdvvakvrrlldll.......kvghvGtLDplatGvLllalgg..atkllsplldvdKtYlatvrlv
00436061   1/1  ltshpvvgklrrll.......gvkkvghvgrLDpdtsGvLvlalgg..atkllsyllkvdKtYlalvllg
00431071   1/1  ltsh.......dvvallkrllgvkkvghaGtLDplatGvLllalgk..atkllsylldadKtYvatvllg
00399761   1/1  ltshd.......vvallkrllgvkkvghaGtLDplatGvLllalge..atkllsylldadKtYvatvllG
00525421   1/1  ltshdvvgkvkrtl.......glkkaghvGtLDplasGvLvvalge..atklvkylldvdKeYvalvrlg
00357941   1/1  rqlilhGhVlVngkvv------------------------------------------------------
00376161   1/1  lnkpnglvvdvedlkgr....vlrlpdreell--------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
00501991   1/1  lteellglldlgvlldg...kpaltlyavlerl.glslleltlltGrthqiRvhlaalghpilgdkrygi
00424431   1/1  lalvegvppedglidlplgvllddglklavledgkpavtlfrvlerlg..glslveltlltGRtHQiRvh
00478721   1/1  lteellgtldagvvldg...kpavtlfavlerl.glslleltlltGrthqiRvhlaalghpvlgdkrygi
00501021   1/1  agvpeeeegtilaplvrlpdgrlklavvvleggkpavtryrvlerlgglslveltlltGRtHQiRvhlaa
00518111   1/1  gliteealekllagftgeilqvPpmysavkvdarpvtiyelellefdl....plvllevtcskgtyiRsl
00436061   1/1  latdtgdidgeiletlgrdpltrekiekllasflgeilqvPPlysavkvnGkrlYelaregveveleark
00431071   1/1  latdtldaegeiletadvllteeeiekvlakftgeilqvPPlysavkvnGkrlYelaregievelelrlv
00399761   1/1  latdtldaegeiletadvhlteedleealakflgeilqvPPlySavkvngkrlyelareGievelklrlv
00525421   1/1  vatdtgdlegeileftgeilqvpPlrsavkrdgrrayelarkglevel.......pllllevtcskG..t
00357941   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GTLVLDENLERGEWRRLTKEELEILRANII----------------------------------------
00501991   1/1  gnlllgldlhagelrfltplellll.v-------------------------------------------
00424431   1/1  laalghpilgDplYggllllllllllllr-----------------------------------------
00478721   1/1  gnllllgrlalgawrllflhel.llll-------------------------------------------
00501021   1/1  lghpilgdprygigell-----------------------------------------------------
00518111   1/1  aadlGlaLgvgahvleLrRtr-------------------------------------------------
00436061   1/1  vaitslellefdgplglslvelrvetgrgty---------------------------------------
00431071   1/1  tiyelellsf..dlpllllevscskgtyiRsl--------------------------------------
00399761   1/1  tiyslellefdgpllllevtcskGt..y------------------------------------------
00525421   1/1  yiRslvhdlglpLg--------------------------------------------------------
00357941   1/1  ----------------------------------------------------------------------
00376161   1/1  ----------------------------------------------------------------------
00478711   1/1  ----------------------------------------------------------------------
00395401   1/1  ----------------------------------------------------------------------
00447871   1/1  ----------------------------------------------------------------------
00422061   1/1  ----------------------------------------------------------------------
00471151   1/1  ----------------------------------------------------------------------
00364961   1/1  ----------------------------------------------------------------------