[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56432.1


[Show Plain Result]

## Summary of Sequence Search
   1::652
  21::593  2.7e-78 25.4% 0047567 00475671 1/1   lasmic binding protein-like II          
  33::593  8.8e-71 27.0% 0046378 00463781 1/1   lasmic binding protein-like II          
  31::594    1e-68 27.2% 0044486 00444861 1/1   lasmic binding protein-like II          
  28::593  8.6e-65 26.9% 0051046 00510461 1/1   lasmic binding protein-like II          
  33::593  3.2e-64 27.7% 0049916 00499161 1/1   lasmic binding protein-like II          
  28::593    2e-59 25.4% 0050299 00502991 1/1   lasmic binding protein-like II          
   1::652


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSKSKYLTLAGLVLGTGVLLSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
00475671   1/1  --------------------hldyanpaaakggtlrialsgdpdtldpalatgaasaavlrliyegLvry
00463781   1/1  --------------------------------gtLrialtgdpdtldpalatgsasallllrliyegLvr
00444861   1/1  ------------------------------kggtLrvalsgdpdtldpalatgaasaavlrliyegLvry
00510461   1/1  ---------------------------dakkggtLrialtgdpdtldpalatgaasalvlrliyegLvry
00499161   1/1  --------------------------------gtLrvaltgepdtldpalatgaasa.llrlvyegLvry
00502991   1/1  ---------------------------dakkggtLrialtgdpdtldpalatgaasa.vlrliyegLvry


                         -         -         *         -         -         -         -:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
00475671   1/1  dpdgelvpllAeswe.seDgltytFkLRpgvkfsDGt.....pvtAeDvvfslerlldpgtasplayall
00463781   1/1  ydpedgelvpllAeswevsddgltytfkLRpgvkf..sDGtpltptreltAeDvvfslerlldpgtaspy
00444861   1/1  dedgelvpalAeswevsddgltytfkLRkgvkf..sDGt...pltAeDvvfslerlldpktaspyaslla
00510461   1/1  dedgelvpllAeswevsddgltytFkLRpgvkf..sDGt...pltAeDvvfslerlldpdtaspyaslla
00499161   1/1  dedgelvpllAeswevsddgltytFkLRkgvkfsdGt.....pltaeDvvfslerlldpgtaspy.....
00502991   1/1  dpedgelvpllAeswevsddg.tytfkLRpgvkf..sDGt...pltAeDvvfslerlldpdaspyaslls


                         +         -         -         -         -         *         -:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
00475671   1/1  llliknalailagglladiegveavddytveitlkkpdplfllllaspalailpkhaleklgddl..tla
00463781   1/1  a....ikgadeyldgk.alldliegveavddytveitlkkpdplfllllalpalailpkhaleklgddfg
00444861   1/1  lik.................gveavddytveitlkkpdplfllllaspalailpkhalekvgddf....a
00510461   1/1  nik.................gveavddytvvitlkkpdplfllllalp.lailpkhalekvgddlllgla
00499161   1/1  .asllslik.........gveavddytveitlkkpdplfllllalpallailpkhaleklgadfl...ae
00502991   1/1  lik................gveavddytvritlkkpnplfllllalp.lpilpkhalekvgddfgtdlla


                         -         -         -         +         -         -         -:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
00475671   1/1  enpvgtGPyklkewdpgerivlernpdYwgkklpkldrivfrvip..dasarlaallsGevDvallvppd
00463781   1/1  tdllaenpvgtGPyklkewdpgqrivlernpdYwg.gkpkldrivfrvip..dasarlaallsGevDval
00444861   1/1  enpvgtGPyklkswkpgqrivlernpdYwgkgkpkldrivfrvip..dastrlaallsGevDval.elpp
00510461   1/1  tlaenpvgtGPyklkewdpgqrivlernpdYwg.gkpkldrivfrvip..dastrlaalksGevDva..e
00499161   1/1  npvgtGPyklkewepgqrivlernpdYwggk.pkldrivfrvi..pdasarlaallsGevDvalellswl
00502991   1/1  enpvgtGPYklkewdpgq.ivlernpdYwgkdlpvgkpkldrivfrvip..dasarlaallsGevDva..


                         -         *         -         -         -         -         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
00475671   1/1  dl.alllkdlpglevvsvpglgtyylafNtrkp..................pfddvrvRqAlalaidrea
00463781   1/1  e.lppddlatlkkdpglkvvsvpslgt.yylafNtrkp..................pfddvrvRqAlala
00444861   1/1  ddlallk.kdpglkvvsvpslgtyylafNtkkp..................pfddvrvRqAlalaidrea
00510461   1/1  lppddlatlkkdpglkvvsvpslgt.yylafNtrkp..................pfddvrvRqAlalaid
00499161   1/1  ppddlealkknpglevvsvpglgt.yylafNtr..................kppfddvrvRqAlalaidr
00502991   1/1  elppddlatlkknpglkvvklllpnvpslgt.yylafNtrkp..................pfddvrvRqA


                         -         -         -         -         *         -         -:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPEKAKAKFAEA
00475671   1/1  ivdavlg..glgtpansllppglpgyddlpaeaelkpye....................ydpekAkalLa
00463781   1/1  idreaivdavlgg...lgtpansllppglpgydd........................dlkpyeydpekA
00444861   1/1  ivkavlgg...lgtpansllppglpgyndlppye.........................ydpekAkklLa
00510461   1/1  reaivdavlgg...lgtpansllppglpgynddlllppye......................ydpekAka
00499161   1/1  eaivdavlg..glgtpansllppglpgynddlp.........................pyeydpekAkal
00502991   1/1  lalaidreaivdavlgg..lgtpanslfsn..................llppglpgydpdlpgllpyeyd


                         -         -         +         -         -         -         -:490
query           KKELEAKGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
00475671   1/1  eaGy.........pdgkpltltllltsdspelkriaeaiqqqlkkiGikvelrvvdwatyldrlr.....
00463781   1/1  kalLaeaGy...pdgkpltltlltvsrsdnpelkaiaeaiqqqlkk.iG...ikvelrvvdwatyldrlr
00444861   1/1  eagy...........pdgkpltltlltdsptakaiaeaiqqqlkkiGikvelrvvdwatyldrlllkdp.
00510461   1/1  lLaeaGykdlggdgirekdgkpleltlltpsgnpelkaiaeaiqqqlkkiGikvelrvv.....dwatyl
00499161   1/1  LaeaGyklldgdgirepdGkpltltlltpsgspalkriaeaiqqqlkklGikvelrvvdwatyl......
00502991   1/1  pekAkalLaeaGytkkdgdgirelpdGkpleltlltpsgnperkaiaeaiqqqlkkiGikvelrvvdwat


                         *         -         -         -         -         +         -:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
00475671   1/1  .agdfdlallgwgadypdpdsflllllsg..............ggsnlsgysnpeldalleealaetdpe
00463781   1/1  ......agdfdlallgwgadypdpdnflsllygsdaa..ggglnlsgysnp........eldalldeala
00444861   1/1  rsgdfdlallgwgadypdpdnflsllysssaad.ggslnlsgysnp........eldalldealaatdpe
00510461   1/1  drlraggpdfdlallgwgladypdpdnflslllss......gglnlsgysnp........eldalldeal
00499161   1/1  drlrngdfdlallglwgady.dpdnflsllfgsdaadgglnlsgysnpeld...........alleeala
00502991   1/1  yldrlr......sgdfdlallgwglgdypdpdnflsllyssdaadlgllggsnlsgysnp........el


                         -         -         -         *         -         -         -:630
query           YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKARE
00475671   1/1  erkalyaeaqrilaedapviplyhlvlvvavsk-------------------------------------
00463781   1/1  etdpeeraelyaeaqrilledapviplyylvlv-------------------------------------
00444861   1/1  eraalykeaqkilledapviplyylvllvavnkk------------------------------------
00510461   1/1  aetdpeerkelyreaqrilledapviplyylvl-------------------------------------
00499161   1/1  etdpeerkalyreaqrilaedapviplyhlvll-------------------------------------
00502991   1/1  dalleealaatdpeerkelyreaqrilledapv-------------------------------------


                         -         +         -         -         -         -         *:700
query           KWLKEKEESNKKAQEELAKHVK------------------------------------------------
00475671   1/1  ----------------------------------------------------------------------
00463781   1/1  ----------------------------------------------------------------------
00444861   1/1  ----------------------------------------------------------------------
00510461   1/1  ----------------------------------------------------------------------
00499161   1/1  ----------------------------------------------------------------------
00502991   1/1  ----------------------------------------------------------------------