[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56471.1


[Show Plain Result]

## Summary of Sequence Search
   1::234
  70::174  3.6e-06 28.9% 0047567 00475672 2/2   lasmic binding protein-like II          
  72::174  0.00017 29.5% 0051046 00510462 2/2   lasmic binding protein-like II          
  70::175  0.00018 25.0% 0044486 00444862 2/2   lasmic binding protein-like II          
  70::174  0.00025 30.9% 0046378 00463782 2/2   lasmic binding protein-like II          
  70::174   0.0027 26.3% 0050299 00502992 2/2   lasmic binding protein-like II          
  70::200    0.003 25.2% 0049916 00499162 2/2   lasmic binding protein-like II          
  18::68    0.0034 25.5% 0051046 00510461 1/2   lasmic binding protein-like II          
  18::68    0.0051 25.5% 0047567 00475671 1/2   lasmic binding protein-like II          
  18::68     0.011 26.0% 0050299 00502991 1/2   lasmic binding protein-like II          
  23::68     0.028 23.9% 0046378 00463781 1/2   lasmic binding protein-like II          
  24::68     0.034 26.8% 0049916 00499161 1/2   lasmic binding protein-like II          
  21::68     0.043 25.0% 0044486 00444861 1/2   lasmic binding protein-like II          
   1::234


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVLSTLAILVACGKTDKEADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQ
00475672   2/2  ---------------------------------------------------------------------a
00510462   2/2  ----------------------------------------------------------------------
00444862   2/2  ---------------------------------------------------------------------s
00463782   2/2  ---------------------------------------------------------------------a
00502992   2/2  ---------------------------------------------------------------------s
00499162   2/2  ---------------------------------------------------------------------n
00510461   1/2  -----------------dakkggtLrialtgdpdtldpalatgaasalvlrliyegLvrydedgelvp--
00475671   1/2  -----------------hldyanpaaakggtlrialsgdpdtldpalatgaasaavlrliyegLvryd--
00502991   1/2  -----------------dakkggtLrialtgdpdtldpalatgaasa.vlrliyegLvrydpedgelv--
00463781   1/2  ----------------------gtLrialtgdpdtldpalatgsasallllrliyegLvrydpedgel--
00499161   1/2  -----------------------gtLrvaltgepdtldpalatgaasa.llrlvyegLvrydedgelv--
00444861   1/2  --------------------kggtLrvalsgdpdtldpalatgaasaavlrliyegLvrydedgelvp--


                         -         -         *         -         -         -         -:140
query           KDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEK
00475672   2/2  gdfdlallgwgadypdpdsflllllsg..............ggsnlsgysnpeldalleeala.etdpee
00510462   2/2  -dfdlallgwgladypdpdnflslllssgglnlsgysnp..............eldalldealaet.dpe
00444862   2/2  gdfdlallgwgadypdpdnflsllysssaadggslnlsgysnp.........eldalldeala.atdpee
00463782   2/2  gdfdlallgwgadypdpdnflsll.ygsdaaggglnlsgysnp.........eldalldealaet.dpee
00502992   2/2  gdfdlallgwglgdypdpdnflsllyssdaadlgllggsnlsgysnp.........eldalleeala.at
00499162   2/2  gdfdlallglwgady.dpdnflsllfgsdaadgglnlsgysnpeld...........alleeala.etdp
00510461   1/2  ----------------------------------------------------------------------
00475671   1/2  ----------------------------------------------------------------------
00502991   1/2  ----------------------------------------------------------------------
00463781   1/2  ----------------------------------------------------------------------
00499161   1/2  ----------------------------------------------------------------------
00444861   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RYEKYAKAQAWSTDSSLLMPTASSGGSPVVSNVVPFSKPYSQVGIKGEPYIFKGMKLQKDIVTTKEYNEV
00475672   2/2  rkalyaeaqrilaedapviplyhlvlvvavsknv------------------------------------
00510462   2/2  erkelyreaqrilledapviplyylvllvavskr------------------------------------
00444862   2/2  raalykeaqkilledapviplyylvllvavnkkvk-----------------------------------
00463782   2/2  raelyaeaqrilledapviplyylvlvvavskrv------------------------------------
00502992   2/2  dpeerkelyreaqrilledapviplyylplvvav------------------------------------
00499162   2/2  eerkalyreaqrilaedapviplyhlvlllavskrvkgvplnpl.......wwlidllll----------
00510461   1/2  ----------------------------------------------------------------------
00475671   1/2  ----------------------------------------------------------------------
00502991   1/2  ----------------------------------------------------------------------
00463781   1/2  ----------------------------------------------------------------------
00499161   1/2  ----------------------------------------------------------------------
00444861   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FKKWQKEKLESNSKYQKELEKYIK----------------------------------------------
00475672   2/2  ----------------------------------------------------------------------
00510462   2/2  ----------------------------------------------------------------------
00444862   2/2  ----------------------------------------------------------------------
00463782   2/2  ----------------------------------------------------------------------
00502992   2/2  ----------------------------------------------------------------------
00499162   2/2  ----------------------------------------------------------------------
00510461   1/2  ----------------------------------------------------------------------
00475671   1/2  ----------------------------------------------------------------------
00502991   1/2  ----------------------------------------------------------------------
00463781   1/2  ----------------------------------------------------------------------
00499161   1/2  ----------------------------------------------------------------------
00444861   1/2  ----------------------------------------------------------------------