[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56555.1


[Show Plain Result]

## Summary of Sequence Search
   1::408
   1::406  6.2e-15 21.9% 0042480 00424801 1/1   eneral substrate transporter            
   1::404    1e-11 23.4% 0042501 00425011 1/1   eneral substrate transporter            
   1::408


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAILLITISETLPQVLQIFLGVLADFQH
00424801   1/1  Mk.ekrrrvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllgaalgsplaGrlsDr
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff


                         -         -         *         -         -         -         -:140
query           HRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLVAFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAE
00424801   1/1  fGrrkvlllglllfalgslllafaptys.tslwlllllr.flqGlgagglfpaalaliaelf....ppee
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallg.pslalllllr.flqGlgagglfpaa


                         +         -         -         -         -         *         -:210
query           AIGFKQSTVSLVKTISNILGGVLLGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTINYQEGLSVK
00424801   1/1  rglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpesprflaakgkle
00425011   1/1  lallaewf....ppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllallllll


                         -         -         -         +         -         -         -:280
query           SFCQHLLQSSKLIWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALI
00424801   1/1  e.....ekkaslklslkellknprllllllavfllflgfyalltylplylqslfevlglsasqaglllal
00425011   1/1  lpesprflllkglseeerkvlerrlkadaeakaasplsllellrnprflllllayfllflgfyglltflp


                         -         *         -         -         -         -         +:350
query           VGSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQELVFKQIPXE
00424801   1/1  fglggilgsllagrlsdrlgrrrllligllllalgllllalapslwllllllillgfgfglafpllfall
00425011   1/1  lylqe..vlglsasqaglllalfglgg.ilgsllagrlsdrlpegrrrrllliglllaalgllllallpg


                         -         -         -         -         *         -         -:420
query           SMGAVQSSISAXTVVLPSLFTISLVTIATSFGTLAVSFVLLLFXLVAFVMLLNIRESI------------
00424801   1/1  selfppelrgtalgllnllagslggalgpllagllldalgysaaflllaalallal--------------
00425011   1/1  tslallllllfllgfglggafpllfalvaelfppelrgtasgllnlagnlggal----------------