[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56614.1


[Show Plain Result]

## Summary of Sequence Search
   1::195
  31::80   1.7e-09 39.6% 0036696 00366961 1/1   domain                                  
  32::80     2e-09 47.9% 0051227 00512271 1/1   domain                                  
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIY
00366961   1/1  ------------------------------slltytVksgdtlssIarrygvsvsellklNgl..pdlll
00512271   1/1  -------------------------------lltytVksgdtlssiarkygvsveellklNgl.npdlll


                         -         -         *         -         -         -         -:140
query           VDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSY
00366961   1/1  pgqvllipvg------------------------------------------------------------
00512271   1/1  vGqvLlipvp------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY---------------
00366961   1/1  ----------------------------------------------------------------------
00512271   1/1  ----------------------------------------------------------------------