[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56631.1


[Show Plain Result]

## Summary of Sequence Search
   1::98
   6::98   0.00013 30.1% 0049598 00495981 1/1   riocin immunity protein-like            
   1::98


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEPNLESLIKDLYNHARHDLSEDLVAALLETAKKLPTTNEQLQAVRLSGLVNRELLLNPKHPAPELLNL
00495981   1/1  -----LldalsvayndpevkadeeLrellleaakeldkgedekayllvatkLdqllssYllthnfqaPks


                         -         -         *         -         -         -         -:140
query           ARFIKREEAKYRGTATSALMYEELFKML------------------------------------------
00495981   1/1  lleLylliakyiavsgiaaekyrGlaaa------------------------------------------