[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56657.1


[Show Plain Result]

## Summary of Sequence Search
   1::189
  81::157    2e-24 55.8% 0049556 00495561 1/1   ed helix" DNA-binding domain            
   1::80   3.7e-14 42.3% 0049555 00495551 1/1   ed helix" DNA-binding domain            
   1::189


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
00495561   1/1  ----------------------------------------------------------------------
00495551   1/1  pelsllelkriiEAlLfvag.ePlsleeLaellgegldeeeveealeeLaeeyeed.grglelvevaggy


                         -         -         *         -         -         -         -:140
query           FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
00495561   1/1  ----------ellplklsqaaletLaiiaykqPvtraeieeirGvdsdgvlktLlerglieevgrkeepg
00495551   1/1  rlqtrpelae------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ---------------------
00495561   1/1  rpllygttekFlelfgl-----------------------------------------------------
00495551   1/1  ----------------------------------------------------------------------