[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56666.1


[Show Plain Result]

## Summary of Sequence Search
   1::480
   4::295 1.5e-119 59.7% 0052576 00525761 1/1   mine synthetase/guanido kinase          
   1::295 1.5e-113 56.7% 0051614 00516141 1/1   mine synthetase/guanido kinase          
   1::295 2.4e-110 56.4% 0052392 00523921 1/1   mine synthetase/guanido kinase          
 296::402  1.8e-33 46.7% 0052575 00525751 1/1   YqeY motif                              
 322::475  1.5e-20 30.2% 0041377 00413771 1/1   YqeY motif                              
 296::355  9.5e-18 47.5% 0052390 00523901 1/1   YqeY motif                              
 296::352  1.8e-15 48.2% 0051612 00516121 1/1   YqeY motif                              
   1::480


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
00525761   1/1  ---elviGlEvHvqLntksKlFsgastefgdepntlvslvdlglpGalPvlnkeavelalklalalnaei
00516141   1/1  leellleelelviGlEvHvqLntk.KlFcgcptefgdeldlellrrlrptlselgeldeaallelekgkk
00523921   1/1  ldleelelviGlEvHvqLntksKlFcgcstefgdeeldlellrllrpllselgeldeaallelekskkll
00525751   1/1  ----------------------------------------------------------------------
00413771   1/1  ----------------------------------------------------------------------
00523901   1/1  ----------------------------------------------------------------------
00516121   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
00525761   1/1  aelslfdrKnyfypdlpkgyQitqldlPialnGllelel.dgglkkvgierihlEedagkllhe.gglsl
00516141   1/1  llyepntnvsplvlglpgalpvlnkeavelallvalalnceivdlslfdRKnyfypdlpkGyQitq...p
00523921   1/1  yepntnvsplvlglpgalpvlnkeavelallvalalnceivdlslfdRKnyfypdlpkgyQitq...pia
00525751   1/1  ----------------------------------------------------------------------
00413771   1/1  ----------------------------------------------------------------------
00523901   1/1  ----------------------------------------------------------------------
00516121   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTK
00525761   1/1  vdlnRaGvPLiEivtePdlrspeeavaylkklrlilrllgvsdakmeeGslRvDvnvsvrplgeeelgtr
00516141   1/1  ialnGylelel.....kkvgierihlEeDaakliheggdlslldlnRaGvPLiEivtePdirspeeavay
00523921   1/1  lnGylel.....slkkvgierihlEeDaaklihelgdlslldlnRaGiPLiEivtePdirspeeavaylk
00525751   1/1  ----------------------------------------------------------------------
00413771   1/1  ----------------------------------------------------------------------
00523901   1/1  ----------------------------------------------------------------------
00516121   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLF
00525761   1/1  vEiKnlnslrlvekaieyeierqielleiggevlqetrlldeldgetvllRskegaadYryfpepdlppl
00516141   1/1  lkklrlllrllgvsd..meeGslRvDvNvsir......lgtrvEiKnlnslrliekaieyeierqlelle
00523921   1/1  klrlllrllg...vkmeeGslRvDvNvsir......lgtrvEiKnlnslrliekaieyeierqlelleig
00525751   1/1  ----------------------------------------------------------------------
00413771   1/1  ----------------------------------------------------------------------
00523901   1/1  ----------------------------------------------------------------------
00516121   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEV
00525761   1/1  visdelleelkallP-------------------------------------------------------
00516141   1/1  iggelkergvlqeTr-------------------------------------------------------
00523921   1/1  gelkergvlqeTrla-------------------------------------------------------
00525751   1/1  ---------------ElPdekrerfveeyglseydaevLtsdleladyFeevvkagadpklaanwllgel
00413771   1/1  -----------------------------------------mslladlfedlkaamkakdklrlntlrl.
00523901   1/1  ---------------ElPdekrerfveeygLseydaevLtssr.ladyFeevvklgvdpklaanwllgel
00516121   1/1  ---------------ElpdekrerfvkeygLseydAevLtsdkel.dlFeelvklgvdpklaanwllgel


                         -         -         -         -         *         -         -:420
query           AQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAIL
00525761   1/1  ----------------------------------------------------------------------
00516141   1/1  ----------------------------------------------------------------------
00523921   1/1  ----------------------------------------------------------------------
00525751   1/1  lgllneegldieelpltpeqlaeLlkliddgtisgkiakevleellegggdP------------------
00413771   1/1  llaalkneevdlgeleltdeellevlkli......vkqrkesieelleggredlaekekaeieileeyll
00523901   1/1  lglln-----------------------------------------------------------------
00516121   1/1  lg--------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN----------
00525761   1/1  ----------------------------------------------------------------------
00516141   1/1  ----------------------------------------------------------------------
00523921   1/1  ----------------------------------------------------------------------
00525751   1/1  ----------------------------------------------------------------------
00413771   1/1  eqlsdee.leaivdeviae.......lgagklkamgklmgavmkklkGkadgklv---------------
00523901   1/1  ----------------------------------------------------------------------
00516121   1/1  ----------------------------------------------------------------------