[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56676.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
   5::363  2.9e-96 38.4% 0046206 00462061 1/1   ependent transferases                   
   5::363  8.7e-91 37.6% 0052302 00523021 1/1   ependent transferases                   
   4::363  5.1e-85 37.9% 0038034 00380341 1/1   ependent transferases                   
   3::363  5.8e-79 35.7% 0036780 00367801 1/1   ependent transferases                   
   1::363  6.1e-79 36.3% 0041260 00412601 1/1   ependent transferases                   
   1::365  1.7e-71 31.9% 0051195 00511951 1/1   ependent transferases                   
   9::365  2.2e-70 33.7% 0047340 00473401 1/1   ependent transferases                   
   1::363  8.4e-62 27.5% 0040526 00405261 1/1   ependent transferases                   
   6::365  2.1e-61 31.5% 0048952 00489521 1/1   ependent transferases                   
   3::363  6.6e-60 30.9% 0051757 00517571 1/1   ependent transferases                   
  57::366  5.3e-59 32.5% 0048747 00487471 1/1   ependent transferases                   
   6::366  6.2e-59 31.3% 0046165 00461651 1/1   ependent transferases                   
   2::363  2.2e-55 29.2% 0040134 00401341 1/1   ependent transferases                   
  27::363  7.5e-50 30.9% 0040897 00408971 1/1   ependent transferases                   
  31::365  4.4e-49 29.8% 0045973 00459731 1/1   ependent transferases                   
  23::363  2.4e-48 28.9% 0042144 00421441 1/1   ependent transferases                   
  47::363  2.9e-46 26.5% 0039341 00393411 1/1   ependent transferases                   
  48::365  3.1e-45 29.7% 0052731 00527311 1/1   ependent transferases                   
  43::363  5.4e-45 23.8% 0049524 00495241 1/1   ependent transferases                   
  45::362    7e-45 29.6% 0050753 00507531 1/1   ependent transferases                   
  44::365  2.6e-44 27.4% 0045909 00459091 1/1   ependent transferases                   
  43::363  5.1e-44 29.8% 0049070 00490701 1/1   ependent transferases                   
  37::365  1.7e-42 29.1% 0048074 00480741 1/1   ependent transferases                   
  26::363  2.1e-40 28.8% 0036406 00364061 1/1   ependent transferases                   
  14::363  2.4e-39 25.0% 0044083 00440831 1/1   ependent transferases                   
  48::363  4.5e-39 23.9% 0041674 00416741 1/1   ependent transferases                   
  43::366  3.1e-38 24.7% 0046007 00460071 1/1   ependent transferases                   
  48::363  5.5e-37 23.2% 0050390 00503901 1/1   ependent transferases                   
  48::362  9.5e-37 25.7% 0035589 00355891 1/1   ependent transferases                   
  45::363    3e-36 21.6% 0051323 00513231 1/1   ependent transferases                   
  48::363  1.4e-34 27.3% 0044807 00448071 1/1   ependent transferases                   
  42::364  1.8e-34 25.8% 0050261 00502611 1/1   ependent transferases                   
  47::362  2.8e-34 23.3% 0044595 00445951 1/1   ependent transferases                   
  43::365  7.2e-34 26.3% 0049754 00497541 1/1   ependent transferases                   
   7::366  3.1e-32 25.4% 0047441 00474411 1/1   ependent transferases                   
  17::363  3.2e-31 27.5% 0050754 00507541 1/1   ependent transferases                   
  43::362  4.7e-31 23.2% 0052070 00520701 1/1   ependent transferases                   
  43::363  9.2e-31 23.6% 0046056 00460561 1/1   ependent transferases                   
  44::363  2.8e-30 23.6% 0038952 00389521 1/1   ependent transferases                   
  52::363  1.4e-29 23.8% 0041704 00417041 1/1   ependent transferases                   
  43::363  2.4e-26 25.7% 0050157 00501571 1/1   ependent transferases                   
  41::363  2.7e-26 22.3% 0037569 00375691 1/1   ependent transferases                   
  68::362  9.2e-25 21.7% 0047956 00479561 1/1   ependent transferases                   
  24::365    1e-24 21.6% 0046547 00465471 1/1   ependent transferases                   
  40::290  1.8e-24 19.8% 0052862 00528621 1/1   ependent transferases                   
  14::363  8.1e-24 23.0% 0046087 00460871 1/1   ependent transferases                   
  45::361  1.3e-23 23.6% 0046584 00465841 1/1   ependent transferases                   
 127::365    5e-23 22.5% 0042383 00423831 1/1   ependent transferases                   
  68::363  6.1e-23 22.1% 0046024 00460241 1/1   ependent transferases                   
  43::313    7e-23 24.3% 0053335 00533351 1/1   ependent transferases                   
  25::366  1.2e-22 23.9% 0035586 00355861 1/1   ependent transferases                   
  43::363  7.5e-22 22.5% 0046747 00467471 1/1   ependent transferases                   
  25::360  6.4e-21 23.1% 0049486 00494861 1/1   ependent transferases                   
   6::363    2e-20 22.4% 0047095 00470951 1/1   ependent transferases                   
   3::363    9e-19 22.9% 0035700 00357001 1/1   ependent transferases                   
  60::363  9.9e-19 21.3% 0046965 00469651 1/1   ependent transferases                   
  48::363  2.6e-17 24.2% 0052164 00521641 1/1   ependent transferases                   
  45::362  1.1e-16 24.1% 0050076 00500761 1/1   ependent transferases                   
  47::289  1.2e-16 23.2% 0035246 00352461 1/1   ependent transferases                   
  60::364  4.9e-16 22.1% 0050696 00506961 1/1   ependent transferases                   
  48::363  5.9e-16 19.5% 0044523 00445231 1/1   ependent transferases                   
  20::365    5e-14 22.8% 0048571 00485711 1/1   ependent transferases                   
  68::363  2.3e-13 22.0% 0035401 00354011 1/1   ependent transferases                   
  26::269  1.1e-12 24.1% 0046154 00461541 1/1   ependent transferases                   
  68::285  1.3e-09 22.0% 0045171 00451711 1/1   ependent transferases                   
  68::344  4.7e-09 21.2% 0042806 00428061 1/1   ependent transferases                   
  45::363    5e-09 19.7% 0045392 00453921 1/1   ependent transferases                   
  43::201  6.1e-09 24.1% 0035846 00358461 1/1   ependent transferases                   
 127::363  2.3e-08 20.4% 0047670 00476701 1/1   ependent transferases                   
  68::363  8.9e-07 22.5% 0050768 00507681 1/1   ependent transferases                   
  68::341  9.3e-07 18.6% 0046255 00462551 1/1   ependent transferases                   
  68::359  1.9e-06 20.7% 0046089 00460891 1/1   ependent transferases                   
   3::201    2e-06 21.5% 0051993 00519931 1/1   ependent transferases                   
  75::365  5.7e-05 21.1% 0050340 00503401 1/1   ependent transferases                   
  68::200    6e-05 22.6% 0050977 00509771 1/1   ependent transferases                   
  53::341  0.00038 17.7% 0042809 00428091 1/1   ependent transferases                   
  68::359  0.00058 20.6% 0045068 00450681 1/1   ependent transferases                   
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
00462061   1/1  ----rqvggivlilsenappfyvpeavldalteayaegfagyrggygysrlrnptaealeralaalegae
00523021   1/1  ----mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaafealesgyiysriggptveeleea
00380341   1/1  ---llalgtdvihlgsgepdylgpvappiylsstftfevleaviealagggtgydysrgpnptvealeea
00367801   1/1  --kdlsletlaihagsgpdv.lnlvgppiyltnefvfelpeavlealaegltgytysrggnplrealeek
00412601   1/1  ealellalgtdvihlgsnenp.lgavappiyqtptfvldalaealdggrygrgpnpgleeleealaellg
00511951   1/1  llkrllkldtlairagfpllartggvivldlsagtppfpvpeavlealaealaggrygyggnpgveelee
00473401   1/1  --------ealgkdliylgsgapglgtppvvraaaeaaadlfanplsggeysrganptleeleealaell
00405261   1/1  mslttlrvaelakrlanlvpsgilrvladelkaegkdiiklsagepdfgppdeiteaaaealdqgstfle
00489521   1/1  -----mdlsklldrletlalhagllpdvllatgadviplgqgepdvppaveealallgagatgygysrgt
00517571   1/1  --elirketlrlrgginasenvlslnvlgaqtspevieaaeealggygysrggdplreeleellaelfga
00487471   1/1  --------------------------------------------------------deleealaellgae
00461651   1/1  -----kldtllvhagrlldlgtggidliilstgeppfpvpeavlealaealasghlygygpgpgveelre
00401341   1/1  -miplgsetrklldlisndylglaeiyllyasetpvppevlealleallnkygegnpgsryyggtlyvdp
00408971   1/1  --------------------------iplplgepdfpeevleaviealdsgg.ytr..gpgvaeleeala
00459731   1/1  ------------------------------dkllsellelllaagllrldpeifsalrkelkrgkdlinl
00421441   1/1  ----------------------kgviyldsaattpvppevlealaealeslllfgnphslghelsrgatp
00393411   1/1  ----------------------------------------------llgygpspglpelrealaellgar
00527311   1/1  -----------------------------------------------kkiplgspvfdeeeiaavleald
00495241   1/1  ------------------------------------------lldlldirllfpalslfalgkdliyldn
00507531   1/1  --------------------------------------------qpelsqgalelleelqerlaellgad
00459091   1/1  -------------------------------------------ksdliPdfptipeeeieavaealdsgi
00490701   1/1  ------------------------------------------lllelalaldelellealrklfpllkgl
00480741   1/1  ------------------------------------iyldnagptplppavlealleglghrsgygytel
00364061   1/1  -------------------------lnpalsetellrelldlasnnylglasvillgasttpvppavlea
00440831   1/1  -------------lgslpepevgaqgepieliageeyldalvgaglinlghghpdvvidLlsdtltgpvl
00416741   1/1  -----------------------------------------------llrygdptglpelreaiaellgr
00460071   1/1  ------------------------------------------sggsrllygtnplheeleealaellgae
00503901   1/1  -----------------------------------------------mllserldrlgpsvidellelag
00355891   1/1  -----------------------------------------------lgygpppglpelrealaellgar
00513231   1/1  --------------------------------------------klllskrldrlgpspirallllaagp
00448071   1/1  -----------------------------------------------lsygategleelrealaellgad
00502611   1/1  -----------------------------------------lsslplsllldlnlslssrlplvpldlir
00445951   1/1  ----------------------------------------------lelssrldglpaslirellelagg
00497541   1/1  ------------------------------------------nmllserldrlppsailelleladgpdv
00474411   1/1  ------iyldgpgptplppevlealarall..............sh.rsyeftagleelrealaellgad
00507541   1/1  ----------------ryippteeeiaemldaigvssldelfdpipleirrgeglplpdlserevldels
00520701   1/1  ------------------------------------------sggsrlsygttelleeleealaellgae
00460561   1/1  ------------------------------------------lelellRelfplldlnllldgliyldna
00389521   1/1  -------------------------------------------lgYpdsaglpelreaiaeylarryggl
00417041   1/1  ---------------------------------------------------Pevlealaevlesgwlygt
00501571   1/1  ------------------------------------------leellelleslllsllyrlplvivraeg
00375691   1/1  ----------------------------------------gpdvinlgigdpdfplppavlealalaeli
00479561   1/1  -------------------------------------------------------------------dpe
00465471   1/1  -----------------------dliyldnaaptplppevleamaealeklygnpssghelgygatelle
00528621   1/1  ---------------------------------------ladrlknlppsitlallalalellaggkdvi
00460871   1/1  -------------lklllepfrikvvepidptiaeeiekelkraggnlfllasenvyidlvsdaltgspl
00465841   1/1  --------------------------------------------efpllkgliyLdnaalgllppavlea
00423831   1/1  ----------------------------------------------------------------------
00460241   1/1  -------------------------------------------------------------------dpa
00533351   1/1  ------------------------------------------lfkrlgrlppspirgllalladldgkdv
00355861   1/1  ------------------------kvylfsaGPaplppevleaaakellnyqgngasvleishrskefta
00467471   1/1  ------------------------------------------spgsrllygttplhdeleerlaellgae
00494861   1/1  ------------------------liyldsdattppppavlealaealevgdgnygsdpgleelrealae
00470951   1/1  -----llllllfpllllfpllkgliyLdnagptplppevleamleal...............ihhlgpef
00357001   1/1  --kplvylfsaGPa.plppevleamlkelldllgnglsvleish.rskefteileearellaellgapdd
00469651   1/1  -----------------------------------------------------------reaiaeyllrr
00521641   1/1  -----------------------------------------------lrllfpirelfpllmdliyldna
00500761   1/1  --------------------------------------------gtehidflsdnptgphpavlealaea
00352461   1/1  ----------------------------------------------rkfiaeplriksaegvyltdvdgr
00506961   1/1  -----------------------------------------------------------reaiaeylgrr
00445231   1/1  -----------------------------------------------llellaaellaggpdvidlsvge
00485711   1/1  -------------------lelslpllltelpglsselllelllslllslyaplplvivraegaylydvd
00354011   1/1  -------------------------------------------------------------------dpe
00461541   1/1  -------------------------lselllllleglyevdpeiaeliekelkrqgevllliasenylsp
00451711   1/1  -------------------------------------------------------------------dpe
00428061   1/1  -------------------------------------------------------------------dpe
00453921   1/1  --------------------------------------------gytssggttelaealaellaellpld
00358461   1/1  ------------------------------------------lggldllygpsggileleealaelfgad
00476701   1/1  ----------------------------------------------------------------------
00507681   1/1  -------------------------------------------------------------------dpe
00462551   1/1  -------------------------------------------------------------------dpd
00460891   1/1  -------------------------------------------------------------------dpd
00519931   1/1  --kpliyLdgpgpt.plpprvleamaryl...........ihhrspeftelleearellaellgakndlk
00503401   1/1  ----------------------------------------------------------------------
00509771   1/1  -------------------------------------------------------------------dpe
00428091   1/1  ----------------------------------------------------telavelaerlaellplg
00450681   1/1  -------------------------------------------------------------------dpe


                         -         -         *         -         -         -         -:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
00462061   1/1  evvltssgtaAialallallkpGDevlvsdplyggtltllrllgarggivvtfvdgldlealeaaitekt
00523021   1/1  laellgaeealltssgtaAlllallallkpGDevivpaptygstaeairlllkrlGakpvfvdldedlea
00380341   1/1  laellgaeaalvtssgtaAillallallgpGDevlvpdplygstielfglalrlaGaevvfvdlddleal
00367801   1/1  laelegaeealvtssgtaAieaallallkpGdevlvpeplygstlellralakllGaevvfvdlddledl
00412601   1/1  aeevlltsggtaaifallallgpGdevlvpaplygsylalarlalkrlGaevvfvdldledleaaitekt
00511951   1/1  alaellgaeealvtsggtaaillallallkpGDevlvpapaygsylallrlllkrfGaevvfvdlddlea
00473401   1/1  gaeealltsggtaailaalallkpGdevivsdpaygstlallrllleraGaevvfvdlddlealeaaitp
00405261   1/1  esleeaaelfallvsgwlrlsyiygyypnpglpeLreaiaallggvyglavdpenivvtaGatealslal
00489521   1/1  gplrealeerlaellgaeevlltsggteAlelallallkpGdevlvpdptypstlaaarll.a..kvvgv
00517571   1/1  eaalvtssgtaAillallallkpgdeilvsrglyhgslihg...lklsgakvvfvddledlekaikektk
00487471   1/1  ealvtssgteAlelallallkpGDevivpsptygatleairll.akpvfvdvdedggn.dlealeaaitp
00461651   1/1  alaellgaeevlltsggtealelallallkpGdevlvpdptypsylaaarl..l.aevvfvpldedggld
00401341   1/1  lveeleerlaelfgaeaalvftnsGtaAnlaallallkpgdevlvpslahgstlaaarlagakrlgievv
00408971   1/1  ellgaehavatnsgtaAlllallalglgpGDeVivpaltfvstanavlla..Gakpvfvdvdpdtfnidp
00459731   1/1  iasnnylppavleallealtnkygegypgsrlylgteavgplveeleerlaelfgaeadelgvavftssG
00421441   1/1  lleelrellaellgadpaeivftsggtealelallalrayglkpgdevlvsslehgsvlraae.llerlG
00393411   1/1  ygvavdpeeivvtnggtealllallallgpGdevlvpdptypaylaalrlaGaevvfvpldpdggflldp
00527311   1/1  sgvyt..lgptvdelEealaallgakyavavssGtaAlllallallglgpdgkeVivpsltfvatanail
00495241   1/1  aattplppevleamleallellgnphssgyslsrganplveelrerlakllgaddpeeivftsggtealn
00507531   1/1  aanvvltdggtaaleaallalrltpgdevlvpdgahpsnlaalqtlaallGaevvvvplddlealeaald
00459091   1/1  lsytlgpgvkelEeaiaellgakyalavssGtaAlllallalglgpgdeVivpsptfvatanailla..g
00490701   1/1  iyLdnasttpvppavleamlealeelyangpsghelgrgalelveelrerlaellgadpaeivftssgta
00480741   1/1  leelrellaellgadedaeevlltsggtealeaallallkpgdevlvsdpahgstl.yakaakllG.aev
00364061   1/1  llealenkygegypgsrlyqgtlsvdpleeeleerlaelfgaeaailltnsGtaAnlaallallkpgdev
00440831   1/1  taqlaellpgdryyggnpgvdeLeerlaellgaehavftnsGteAnllalkallkpgdevivpdlayggt
00416741   1/1  rrgvavdpeevvvtnggtealelalrallgpGdevlvpsptypgylaaarlaGaevvfvpldedngfgld
00460071   1/1  aallfnsGteAnlaalkallgpgdivivdeltHgstldglrls..gakvvfvphndlealeaalaeatpr
00503901   1/1  gpdvidlgigepdlppppevlealaealdsgalllrypdpaglpelreaiaellgrrygvdvdpeeeilv
00355891   1/1  ygvavdpeeivvtnggtealelalrallgpGdevivpsptypgylaaarllGaevvfvpldpdgtfgldl
00513231   1/1  dvidlgigepdfppppavlealaealdeggalllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvt
00448071   1/1  payevvftsggtealeaallallkp.gdevlvsapghpsvl.laeaaerlGa.evvvvpvdedglldlea
00502611   1/1  elladadgpdvidlgsgepdlglgpppavlealaealaelgpgllgygppeglpelrealaellaelfga
00445951   1/1  pdvidlgvgepdlpppeavlealaealggllgypdppglpelreaiaallgvdpeeivvtsGatealnla
00497541   1/1  idlgsgepdlppppavlealaealdngllgyppsqglpelrealaellaellgadldpetevlltsggte
00474411   1/1  pdvvlltgggtealeaallal.lgpgdkvlvpapgyfsvr.laelaerlgaevvvvpvdpgglvdpeale
00507541   1/1  glasknlgvdplfyldgaattpvppavlealaealtagnpysphelsqga........leleeelaerla
00520701   1/1  evlltssGteAneaallalralgpgdevlvdelahhsildgarll..gaevvvvphndldaleaalteag
00460561   1/1  attplppavleamaealeeyygnphsgghelgrgalelleelrerlaellgadspdevvftsggtealnl
00389521   1/1  vgvdpeeilvtnGatealelllralldpGdevlvpdptYpgylaaarlatgaevvpvpldeeggflldle
00417041   1/1  gpgveeleealaellgaeeavftssgteAlnlallalglgpgdevivpspthvatlaailll..Gakpvf
00501571   1/1  ayltdvdgrryldlssglpvnplGhsppevlealaealdrlgngssygptpgveelrealaellgadpae
00375691   1/1  dldanenplgpslaaldagllrypdpglpelreaiaellgvdpeeilvtnGatealalllrallnpgdel
00479561   1/1  eilvtnGatealalllral.pgdevlvptptYpgylaaarlagaevvpvpldndfgldldaleaaiktpk
00465471   1/1  elrealaellgadpdeiiftsggtealnlallalrrallkpgdeilvsspehpsvlkaaell.erlgaev
00528621   1/1  dlsvgepdfppppavlealaealdgllgypppaglpelreaiaeylerrygvgvdpenilvtnGatealf
00460871   1/1  pamyaalevgddyygggptvdeleervaelfgaehavfthsGtaAnllallallkpGdevivpdhflahg
00465841   1/1  maealeelagngssghrlsrgatelveelreklaellgadpeeviftssgtealnlalkalrlgpgdeil
00423831   1/1  --------------------------------------------------------ealeaaidentalv
00460241   1/1  llkledeivvtnGgtealllalralldpGdevlvpdptYpgylaaaelaGaevvpvpldeeggflldlda
00533351   1/1  idlgvgiyldpepdlppppavlealaealddgagllgypdpaGlpelrealaellarlfgvevdpeeiaa
00355861   1/1  ileearallrellgapedyevlflsGggtaafeaallnl.lgpgdkvlvlvtghfsvr.aaelakrlgle
00467471   1/1  aalvfnsGteAnlaalrallgpgdivlvdelnHgstldglrlsgaevvfvphn.Dldaleallkelreeg
00494861   1/1  llgaeaaeivftsgGteAnllallalldpgdevlvsepahpsvleag.aaellGakvvpvpdedgkldle
00470951   1/1  telveearellaellgadpgeevvftgggtealeaallgl.lkpgdkvlvssnghfsvl.laeiaerlGa
00357001   1/1  yevvlltgggtaaleaallnllgpgdkvlvlvtghfgn.raadlakrlga.evvvvpvdegglldleele
00469651   1/1  rgvgvdpeteilvtnGatealalalrallgpGdevlvpsptypayaaaarlaGakvvfvpldeeggflld
00521641   1/1  gptplppevleamlealishrspeftelveearellaellgadpyeeivftgggtealeaallnl.lkpg
00500761   1/1  llgddlgygadplveeleeklaellgaeaavlftsgGteAnllallaarepgdevivsataHisvleaga
00352461   1/1  eyldalsgynvlllghgdpeiDlltDsgtsaasdaqlaallvgddayggdplafeleealaelfgldavl
00506961   1/1  rgvdvdpeqilvtnGatealelalrallgpGdevlvpsptYpaylaaarl..agakvvpvpldefgldle
00445231   1/1  pdfppppavlealaealddgvlgyypdpglpelreaiaellgrryvdpeeilvtnGatealalllral..
00485711   1/1  GnrylDflagigvvnlGhnhpevveaiadeeqldkllhvallsngaphepaeelaeklaelapegldkvf
00354011   1/1  eilvtnGatealelalralldpGdevlvpdptYpgylaaarlatgaevvpvpldeeggflldlealeaal
00461541   1/1  avlealgsaltn.kyaegypgsryyggteyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaal
00451711   1/1  evvvtnGgtealalalrllallnpgdevlvpdptypgylaaarlagaevvpvpldeengfgldlealeaa
00428061   1/1  rvaivvtnGgtealalalrllallnpgdevlvpdptypnylaiarlaGaevvevpldeendfgldldale
00453921   1/1  rvfftnsGseAnelalklarayylakgrlgtggdkilvfeggYHGrtlgalsltgspsylggfgplgagv
00358461   1/1  daifvtnGtseanlavilallgpGDevlvdrpsHksilnggarlaGakpvylptdrngfggiggirfkhl
00476701   1/1  --------------------------------------------------------eaLeeaieedtaag
00507681   1/1  qilvtnGatealalllralldpGdevlvpsptYpgylaaarlagakvvpvpl..dgfgldlealeaalke
00462551   1/1  nilvtnGasealflllralldpgdevlvpsPtYpgylaaarlagakvvpvpldeengflflldlleleaa
00460891   1/1  eilvtnGatealflllrallnpGdevlvptPtYpgylaaarlagakvvevpldeegglflldlealeaai
00519931   1/1  yteiiftgsgtealeaalanlllllkpgdkvlvsanghfsvr.waeiaerlgaevtvllpvdwggpvdle
00503401   1/1  ----gtgafeaallnl..lgpgdkvlvlvtghfsn.raadeakrlga.evvvldaddgglldleeleeal
00509771   1/1  qilvtnGatealalllralldpgdevlvpdptYpgylaaaelagakvvpvpldeeggflldlealeaalt
00428091   1/1  ldrvfftnsGseAneaalklarayalakgtp.rdkilvfegaYHGrtlgalsltgsklyhaslfgpllpg
00450681   1/1  rvaivvtnGatealllaarflallnpgdevlvpdptypnylaiaklagaevvpvplddengfgldleall


                         +         -         -         -         -         *         -:210
query           YIETPTNPLMLEFDIEKLAKLAHAKGAKVVVDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
00462061   1/1  kliflespsNptgtvldlaaiaelAhevgallvvDntyaapllldpldlgadvvvhsttKklgghggvrg
00523021   1/1  leaaitpktkaiilehpsnptGtvadleaiaelakkhgilvivDeaqatggllydglelgadivvfSfsK
00380341   1/1  eaaitprtklvvlespsnptgtvadleaiaelahkhgalvivDeayatgvlgdplalgadivvgslsKal
00367801   1/1  eaaitpktklvllespsnptgtvldleeiaelahenhgalvivDeayaagvlldplelgadivvgslsKy
00412601   1/1  klvflespnNptgtvldleeiaelakkhllnpgalvvvDeayatpvlgdplelgadivvhSlsKalggag
00511951   1/1  leaaitpktklvvlespsnptgtvldleaiaelahehgallivDeayaagvlgdplelgadivvgslsKa
00473401   1/1  rtklvllespsnptGtvldleeiaelahehgalvivDeayaagllgdplelgadivvgslsKylgghgdl
00405261   1/1  lalldnltnlllkpgdevvvpdptYpgylrlakllgakvvfvdl...dlealekaitpktklvflesPnN
00489521   1/1  pvdedggldlealeaaietpktkavilespnnptGvvldleeiaelakehgallivDeayaggalgdple
00517571   1/1  lvvl..psnptgrilsledlkeiaeiakeygallivDeahgaglvggpllpsplelgaDivvgSlhKtlg
00487471   1/1  ktkaiilehpsnptGtvldleeaiaelakkhgillivDeayalgvlgdplelgadivvfSfsKalgGptG
00461651   1/1  lealeaaitpktklvvlenpnnptGvvldleeiaelakelghgallivDeayalgvlgdplelgadivvg
00401341   1/1  fvdvdpetglidlddleaairprtklivleh.snptGrvadleeiaelaheygallivDeAhaagllalg
00408971   1/1  ealeaaitprtkaiv...pvnptGavadleaiaelarehgllvivDaahalgalyggrhpgslgadivsf
00459731   1/1  taAlllallallkpgdevlvpslahggstlaa..arllGagvnfsgllfkvvfvdvddetgnidledlea
00421441   1/1  aevvlvpvdpdgrldlealeaaidpntklvvlehpnnptGvvlpleeiaelahehgallivDaaqaagal
00393411   1/1  ealeaaitpktklvllvnpnNptGtvldleelealaelarehgllvivDeayaelaydgrpapsllsldp
00527311   1/1  la..gakpvfvdvdpdtnidpedleaaitpktkaii...pvnllGqvadldeiaeiakkhglllieDaaq
00495241   1/1  lallalalaglkpGdevivsapehpstlaawrllaerlGaevvfvdvdedglidlealeaaitpkTklva
00507531   1/1  edtaavllehp.nptGvvldlaalaelahaaGallivDaaqaalgllvdpgalgadivvgslhKllgPhg
00459091   1/1  akpvfvdvdpdtfnidpedleaaitpktkaii...pvnptGnvadldaiaeiakkhgllvieDaayalga
00490701   1/1  alnaallalgaallsplkpgdevlvsalehgsvlaalallaerlGaevvfvdvidlealeaaltpdtklv
00480741   1/1  vfvpldedglidlealeaaitegpktklvvlehpsnptGvvldleeiaelakehgallivDaayaagalp
00364061   1/1  lvddlahgstlagarlanasglGaevvfvpvdedglidledleaalkektklivles.snptGvvadlke
00440831   1/1  teag..llagakpvfvdvdedgnldlealekaitevgaektkaiileppanptGvlplspadlkaireia
00416741   1/1  lealeaaitpktkavilenpnNPtGvvldleelealaelakkhglllivDeayaglvydgkplsalalld
00460071   1/1  tkavvvesvfsptGdiaplaeiaelarkhgallivDeahaggvlgrtgrgllellglgadivvgtlsKal
00503901   1/1  tnGgtealelalralldpGdevlvpdptYpgylaaarlaGakpvfvpldedgllplllglendflldlea
00355891   1/1  ealeaaitprtkaiilenpnNPtGtvldleelealaelarehglllivDeayaglvydgklpgslaeldg
00513231   1/1  nGatealalllralldpGdevlvpsptYpgylaalrlagakvvpvpldelltggllseggflldlealea
00448071   1/1  leaaleehrtklvilehvnnptGvvlpleeiaelarehgallivDeaqalgalpgdldalgvdivvfslh
00502611   1/1  eaadpeeivltnggteAlelalrallgpGdevlvpdptyhgylaaarll..Gaevvfvpldedgldleal
00445951   1/1  lrallgpGdevlvpsptypaylaalrll..Gakvvfvpldleedgflldlealeaaitprtkaillvnpn
00497541   1/1  alelalrallgpgdevlvpdptypgylaaarll..Gaevvfvpldedgflldlealeaaltektkavile
00474411   1/1  ..tpdtklvllthpenptGvvldlaaiaalarehgpdallvvDaaqslgalpldldelgvdvvvgslqKa
00507541   1/1  ellgadaaivftsggteAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarll..Gaevvevpv
00520701   1/1  pprtklvvlesvnnptGtiaplkeiaeladeygallivDeahaggvlgrtgrglaehlgvepdadivvgt
00460561   1/1  allalaaahlkpgdevlvsalehpsnlaalrllaerlGaevvvvpvdpdglldlealeaaldprtklval
00389521   1/1  aleealtealkegpktkalllpnpnNPtGtvlsleelealaelarkhgillivDeayaelvfdgppfpsl
00417041   1/1  vdvdetgnidlealeaaieehtpktkaii...vvnptGvvadleeiaeiakehgillieDaaqalgalyg
00501571   1/1  vlftnggteAlelalkaarllgpgdevlvpepayHgstlaalrlagakvvevtfvpldpdglllpypdle
00375691   1/1  vlvpdptYpgylaaar..lagaevvpvpldedfgldlealeaal.pktklvvlpnpnNPtGtvlsleele
00479561   1/1  tkllllcnpnNPtGavlsreelealaelarehgillivDeayadlvydgasfvslaslldnvivlrSlsK
00465471   1/1  vevpvdedgrldlealeaaldedtklvvlthpnnptGvilpleeiaelakehgpdallivDaaqaagvlp
00528621   1/1  lalrallnpGDevlvpdptYpgylaaarlagakvvpvpldedgflldlealeaaitpktklillpnpnNP
00460871   1/1  gfletggaallsgatpvfvdydlvdpdtgnidlekleaaikevgapktkliilenpvnpaGgsvysladl
00465841   1/1  vsalehpsvleaarllaerlgaevvfvpldeevdglldlealeaaltpktklvvlehvsnetGvilplke
00423831   1/1  vatagttptGaiddieeiaelaeeygletglgiwlhvDaAyggfllpfleklrpldfglpgvdsisvsgh
00460241   1/1  leaaitpktklivlpnpnNPtGtvlsreeleelaelarehgillivDeayaelvydgepkdalppslasl
00533351   1/1  lltnggtealelalralrklgpgdevivpsptypgylaaarlaGakvvfvpldedgtfgidlealeaait
00355861   1/1  vvlvldaeagglvdleeleealidpdtklvalthnetstGvllpieeia....ehgallvvD..aassig
00467471   1/1  pkpkliivegvfsmtGdiaplkelreladkygallivDeahaggvlgatGrgllehlgvlpdadivtgtl
00494861   1/1  dleaaitedtahgllpklvvltnpnnptGtvyslepleeiaalakehglllhvDgayaggalpglgvsva
00470951   1/1  evvvvpvdegglvdlealeealkepktklvalthvenstGvinpleeiaelahehgallivDavqslgal
00357001   1/1  aalidpdtklvalthnetstGvlnpl.....lakkhgallivDav..ssilarpidvdklgvdyasaqKn
00469651   1/1  lealeaaitpktkaillpnpnNPtGavlsleeleelaelarehgllvieDeayaelvydgkpapslasld
00521641   1/1  dkvlvssnghfsvl.aaeaaerlGa.evvvvpvdpgglvdlealeaaleepdtklvalthvetstGvllp
00500761   1/1  ilglggakvvlvpvdedgkldleaLeaairedtahvhgtrpvlveitgntetGtvysldeleeiaelcre
00352461   1/1  ftnsGteAnelalkallayhrakgepgdtviisngyhgttlehvslagakvvrvpfdpaldealllpedg
00506961   1/1  aleaalteakekgpktkaiilvpnpnNPtGavlsleeleallelarkhdllvieDeayaelvydgkpfps
00445231   1/1  gdevlvp.PtYplyaaaarlagaevvevpldngflldle..itpktkllllnnPnNPtGtvlsreeleal
00485711   1/1  ftnsgseaveaalklarqyglglggsrlvlgtlelheeleellad.tgrekilvfsggyhgntlallalt
00354011   1/1  teapegglktklvllpnpnNPtGtvlsreeleellelarehglllivDeayaelvfdgapfpslasllle
00461541   1/1  lal.lkpgdevltpslehgGhlthgstfdatalalsglgaepvfydvdpetglidpdaleealrertpai
00451711   1/1  laeatektkllllnnpnNPtGavlsreeleelaelakehglllivDeayaglvyggeedapsllaladal
00428061   1/1  aalteapektkllllnnpnNPtGtvlsleelkalaelakehgillvvDeaYagfafggeedapsilelag
00453921   1/1  vvvpypdlealeaaie..pdtvaavivepvqgegGvivpppeflkalrelcrkhgillivDEvqtgfgrt
00358461   1/1  dpealeealtelkpeglrplpktkavvltnp.nptGtvypleeiaelakkhglyllvDeAh---------
00476701   1/1  lipaavvatagttptGaidpleeiaeicrehgiwlhvDaAygggalpfpeyrllldgiegaDsitfslhK
00507681   1/1  akeatpktkliylvpnpnNPtGavlsleeleallelarkhdllvieDeayaelvydgapfpslasldapd
00462551   1/1  itpktkllllcnPnNPtGavlsreelealaelarkhgllvisDEiYadlvfdgepppsllldaydrvivl
00460891   1/1  tepktkllllcnpnNPtGavlsreelealaelarkhdllvisDeaYadlvfdgapfpslasllpdlydrv
00519931   1/1  eieealdepdtklvalvhvetstGvlndikeiaelakelshgallvvDavqslgalpidvd---------
00503401   1/1  lnpdtklvavthneTstGvlnpleei.....dhgallvvDav..sslgslpidvdklgvdf..fsaqKnl
00509771   1/1  pktklvlltnPnNPtGtvlsleeleallelarkhgllvisDeayaelvydgpfpslasld----------
00428091   1/1  vvgvpapylyrteelgyndldaleallaehgekiaavivepvvqgegGvivpppeflkalrelcdkhgil
00450681   1/1  aalteapektkllllnnpnNPtGtvlsreelkelaelakehglllivDeaYqgfaydgldedalavrsfl


                         -         -         -         +         -         -         -:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
00462061   1/1  Gylvgnpellaallkvlprllggplspfqaalllrgletlplrverhtenalalaellaalplvakvlyp
00523021   1/1  ylggtGdrlGglvvtndkelierlrplrsggtsisyvglvtldllprrfeagtpnvagliglgaalsplq
00380341   1/1  ggpgdrlgGyvvgsd.eliealrklrlgggfggtlspaaaaallrgletlelrrarlrenadllaeaLae
00367801   1/1  lggpgdlrgGyvagsee.liealrklrpggglggtlspaaaaallrgletlelrreraqenadylaelLe
00412601   1/1  dlriGyvvgnde.lidalrklrgpltgstlspaaaaaalrgletlelrrerlaenaallaeaLeelgpgv
00511951   1/1  lggpgdlrgGylvgs.eeliealrklllggglggtlspaaaaaalagletleerrarlrenadrlaeaLa
00473401   1/1  raGylagre.elidklrgllvglgggtlspaaaaallaaletlelrreralenadylaelLaelpgvylv
00405261   1/1  Ptgtvld.......akehgilvivDeaYaepvydplplaydndivlrSfSKyf.glaGlrlGwavvpdee
00489521   1/1  lgadivvgslsKalggpaGlrgGalvgnd.eliealrklrsggggtlsplaaaallaalegleerrerlr
00517571   1/1  Gp...rgGyiagk.kelieklrkvfpglggspsplvaaallaalktlllrgfkryleealklakalaeyl
00487471   1/1  lrgGalvgndelieallkllrggggggtlsplaaaallaaletleerlerlrenadllaeaLeelpgvtl
00461651   1/1  slsKtlngpgGlrgGalvgnde.liealrkvrrglggtlsplaaaallaalegleerrerlrenadrlae
00401341   1/1  lhglple.gadivvgslhKtlgGp...rgGailvrd.elaeklrsllfgggfggtlspllaaallaalel
00408971   1/1  sasKtltggg...gGavvtndeelaerlrklrnhglsrgllllvlaalllryevlllgynyrlspiqaaa
00459731   1/1  aitepktkaiiv..vasnp.GviadleeiaeiakkhgallivDaAhalgavgldvlpgplg.gaDivsfs
00421441   1/1  pldlgelgaDivvfsahKylggpg...lGallvrd.ellerlrpllhggglekrfeagtpnplaiaalla
00393411   1/1  dalgrdivvfSfsKtlglpglrv.Gylva.dpeliealrklrsgggstpsplaqaalaaaledgeehlee
00527311   1/1  algalykgkklgsfgdivvfSfhatKnltgge...gGavvtndkelaeklrllrnhgisrdglrkyvhll
00495241   1/1  lvhpsnptGvvlpleeiaelahehgalvivDaaqaagalpidldelgaDfvvfsahKwlgppG...iGal
00507531   1/1  lggpgaGalavre.ellralpgrlvgvtgdadgkralrlalqtreqhirrekgtsnictpnglaaaaala
00459091   1/1  lykgkkvgsfgdivvfSfsktKnltgge...gGaivtndkelaeklrllrnhgtsksyhglkyvhlllgy
00490701   1/1  llthvsnptGvlldieaiaalahehGallivDaaqaagllpldvgelgaDfvvfsghKtlgggppglGfl
00480741   1/1  ldplelgaDivvfslhKalggppgv..Gallvrk.elieklrpllpgglldlvlalkylgavlgfftgtp
00364061   1/1  iaelaheygallivDeahaagllgldgrppgelgaDivtgslhKtlgGp...rgGyiagkdelqeliekl
00440831   1/1  dkhgillivDeahaaglaytgklfgseyagvaigelvpdlfggadivsfslsKtlggp...rgGailtnd
00416741   1/1  algrvivlgSfsKalglpGlrlGylva..dpeliealrklrsggtfgpsplaqaaaaaaledeleelrer
00460071   1/1  .Gg..rgGavlgseelidalrplarggtfsgslnplaaaaalaalelleeegleelrerlaelaarlreg
00503901   1/1  leaaitprtkaiilpnpnNPtGavlsreelealaelarkhglllieDeayaelvydgkpfpslasldgey
00355891   1/1  vdivlgsfsKalglpGlrlGylva..dpeliealrklrsggtlgpsplaqaaaaaaledlelleehleel
00513231   1/1  aitpktkliilnnpnNPtGtvlsreelealaelakkhglllisDeayaelvydgapftsllslpdaldrv
00448071   1/1  Kalggglgl..Gallvse.ellerlrpllsggtslyldlllllkyeqerrfragtpnplaaaallaalel
00502611   1/1  eaalteagadgllpktkavilepnpnnptGvvlppeelealaelarehgallivDeayagfvytgkpags
00445951   1/1  NPtGavldleelealaelarehgllvieDeayaelvydgpfpsladldagrvivlfSfsKtlglpGlrvG
00497541   1/1  ppnnptGvvlpleeleelaelarehgillivDeayagfvytgklpvslaellgvagadivvgSfsKal.g
00474411   1/1  lggppgl..Gflavsp.ellerleplsgylglallldlqekrfepgtppvlaiaallaalellleegle.
00507541   1/1  dedgridlealeaaidertaavvltnpnnptGviepleeiaelahehgallivDeayagglglgvdpgdl
00520701   1/1  lhKal.Gp..rgGalagseelidalrplarggtfsgtlnplaaaaalaalellgeegleelrerlralaa
00460561   1/1  thvsnvtGvilplaeiaalahehgalvlvDaaqaagalpldlgelgaDfvvfsghKllGppG...vGfly
00389521   1/1  asldgallllpldlgrvivlgSfSKtlgl.pGlRlGylvakppeliealrklrsp.ls.vsslaqaaaaa
00417041   1/1  glkaggfggadifsfslsKtlggg.g..gGalltndeelaerlrplrlggisidlkylvqelgfnsgtsp
00501571   1/1  aleaaitpktaavileppqnptGvvlpspeyleelaelarehgallivDeayagfgrtglpfapealgvd
00375691   1/1  elaela.khgalvivDeayaelvyggpllslldllgrvivlgslsKtlglaGlRvGylvappeliealrk
00479561   1/1  afglaGlRlGylvappeelieallklrs..plgvstlaqaaaaaaledgeyleelrarlrerrdllaeal
00465471   1/1  ldldelgvDfvvfsghKalgppg..iGalyvrkell.lrpllvgggqerrfeagtpnvlaiaalaaalel
00528621   1/1  tGtvlsleelealaelarkhglllivDeayaelvfdgepppslldalgrvivlgsfSKtlglpGlRlGyl
00460871   1/1  kaireiAdkyglllivDaAraagalyaggvtgspyafrsigeivdeifgyadivsfslsKglggp...rg
00465841   1/1  iaelakehnGdlsallivDaaqavgalgldlaglgvDivvfslhKalggpggi..Galyvrk.elldrlr
00423831   1/1  Kyglaplgc..Gvvlvrdkellrealsvnadylggdlgsftlegsrpgaralalwaallslgregyeelv
00460241   1/1  dglgrvivlgsfSKtfglpGlRlGylva..peeliealrklkgggllraltlsvstlaqaaaaaaledgl
00533351   1/1  eapktkaiilepnpnnPtGvvlpleeleelaelakkhgillivDeayagfaydlggkgpsllelldlgpd
00355861   1/1  srpidvsgvdvvvasaqKnlgppG..lgvlivsedllerlepi..lpsyldlgtlaengstynTpptfai
00467471   1/1  sKalggg.rg..Gailgs.kelidklrslarpgifstslnplaaaaalaalelleegeelrerlrenaey
00494861   1/1  eldgaegadvvsfslhKtlggpg..gGallvrdelaealpllrggggetgrrsgllaaaalaalglegle
00470951   1/1  pidvdelgvDflvssshKglggppGl..Gflyvse.kalerlknrklpplsgggdlllllkfmladqerr
00357001   1/1  lGppG..lgvvivsedllerlepilpgyldyktvakngstanTpptlaiyalgaalewlleeggleaiea
00469651   1/1  glldrvivlgSfsKtf.glpGlRlGylva.ppeliealrklrspgnssvstlaqaaaaaaledgeflehl
00521641   1/1  leeiaelahehgallvvDavqslgalpidvdelgvDllvasahKglggppG.lGflyvsedllerlepll
00500761   1/1  hglllhvDgArlgnalgalgvdlaeldgaegaDsvsfslhKglgapg...ggallgrd.eliekarllrk
00352461   1/1  nldledLeklikehgadniaavileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfgf
00506961   1/1  lasldepdrvivlgSfsKtl.lpGlRlGylva..ppeliealrklrsgltlgvstlaqaaaaaaledggy
00445231   1/1  ae.hgllvvsDeaYadlvydsalllleaydnlivlrsfSKaf.glaGlRlGylianpeliealrklrspl
00485711   1/1  gpgdevlvpdplypgylhaallagarvvfvpldvded.ghldlealeaaleeldaggdrtaavilepvqn
00354011   1/1  lglrllpdaygrvivlgsfsKtl.glpGlRlGylva.ppeliealrklksa.tlsvstlaqaaaaaaled
00461541   1/1  ivag.vsaygrladlkelreiadevgallivDaAhaaGlvaagvlpspfg.gadivtft-----------
00451711   1/1  prvivlgSfsKtfglpGlRvGylva..ppeliealakvksqllllirgltlnpptlaqaaaaaaledgal
00428061   1/1  agpnvivlgSfsKtfglaGlRvGylvapaeliealakvlsqlklliraltsnppalaqaaaaaalsdgel
00453921   1/1  gklfafehlgvtpdivtlsKalgggglplgavlgseeiadalgpllhggtfggnplacaaalaalellee
00358461   1/1  ----------------------------------------------------------------------
00476701   1/1  wlgvp..lgcgallvrdkellrralsvdadylgslddggdgvrdlrdftlegsrrfralklwaalralgr
00507681   1/1  rvivlgsfSKtl..lpGlRlGylva.ppeliealrklrslltlgvsslaqaaaaaaledglydehleelr
00462551   1/1  rslSKtfglaGlRlGylvapn..elirallklrspltlgvsslaqaaaaaallaygggeehleelrarlr
00460891   1/1  ivlrslSKtf.glpGlRlGylvapnpelieallklkspltlglvstlaqaaaaaaledgeeyleelrarl
00519931   1/1  ----------------------------------------------------------------------
00503401   1/1  GppG..lgvlivskdllerleplgpsyldlvtlakkgstanTppvlaiyalglalewlkeeggleaiekr
00509771   1/1  ----------------------------------------------------------------------
00428091   1/1  liaDEvqtgfgrtgklfafehagvtpdivtlsKalgggglplgavlgseeiadalapgalgaflhggtfg
00450681   1/1  elldagdnvivlrSfSKtfglaGlRvGylvappevvladaellaalisallklkraltsnpsslaqaaaa


                         -         *         -         -         -         -         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
00462061   1/1  glpshpghllakrqlkglggllsfelkggleaakafldalklfviavslggveslilhpasttharlgpe
00523021   1/1  aalllrgletldlrlerrrenadylaegLaelpgvelvlypglpshpghelakrqlpggaggllsfelkg
00380341   1/1  lpgvvlvlypglpshpghelakrqlpggggivsfelkgdgedaeafadaLkeagiavspggafslilhpa
00367801   1/1  elglvvlvyypglpsgafyllaklpakgrggllsfelkgdaeavaklldelgvavrpgslggveslvihp
00412601   1/1  evvlypglppegahylalrvlklpgaggivsfelkgdaealaalldelgiavrpgslggvesliihpast
00511951   1/1  elggvalvgypglpshpghelakkvlpgrggfvsfdlpgggedaeafadaLkeagiavspgsafslvlhp
00473401   1/1  gypglpshpghelakkvlpgrggfvsfdlkggvdaealadaLeeagiavslgsafslilhpastthaalg
00405261   1/1  lidklrklklpltigvsslaqlaalaalkdpldaylllrgesletlelrrerlrerrellaeaLeelggv
00489521   1/1  enadylaeaLaelggvelvlppglpshpghylavrlprglglllsfelpgdaelakalldelglagiavs
00517571   1/1  yeglkklpglegfkvvspgggnilsfilpvdlgd......gidalelaklllelygiavspgshp.....
00487471   1/1  vlypglpshpghelakklvpggggllsvelkdgedaeelldalkeagiavslgsafslillpasttllal
00461651   1/1  aLaelpgvervlypglpphggfflwvdlpegrgglvsfrlkdgidaealakaleeagifviavspgsafs
00401341   1/1  leeglkerrerlvenaarlaeaLeelgfvvvvgppd.ghlvsvdlpgl.....gidaldlakaLeeagia
00408971   1/1  llaaletlderlerrrenadrlaelLaelpgvelvkppglsshafylfailvlllglgldrdelaeaLee
00459731   1/1  lhKtlggp..pG.Gallvnd.elieklrplrvgglfdlekligrarryffsgtppgarlaalaaalgllg
00421441   1/1  alellgeglealraralelaeylregleelpglelvgppgrrlggivsfelp.gvdaedl..lllergia
00393411   1/1  lrerlrerrdllaeaLaelpgvevvgppg.gfflwvdlpglgldaeelaeaLleeagvavrpgsaf....
00527311   1/1  lgynyrlseiqAalglaqleklderlerrrenaklyaelLkdlpgvklpkypglassvyhlfsillkdgl
00495241   1/1  yvrkelldkllpllrggggivlvslfgltaaeqerrfeagtpnvaaiaalaaalellqeegleairerhr
00507531   1/1  aldllgleglearaeralalanylaaaLeelpgv.rvlgpggaghevsfdl..gvdaedvakallerGva
00459091   1/1  nyrlseiqAalglaqleklderlerrrenaklyaelLkklpgvelpkppglashsayylfpillkdglgl
00490701   1/1  yv..reellerlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellglegleaia
00480741   1/1  nilgiaalaaalellgeeg.gleeilerlreladylyeglkelglellgpdgrgrggivsfrlpdgidaa
00364061   1/1  rrlkaplgfgtalspliaaaalaalelleegleelaerlvenaaylaegLkelgfvvvvgppg.ghivlv
00440831   1/1  eeladklrklrfpgegfplgggyrgspiaaaaallalelleellerrvenakylaeaLeel.gvpvv.gp
00416741   1/1  lrerrdllaeaLeelg..levvgpsggfflwldlp.gldaeelaealleagvlvrpgsaf..........
00460071   1/1  Laelg.levv..pglglivpvelgdg......ldalalaeallerGilvrpisypav.............
00503901   1/1  grvivlgSfsKtlglpGlRlGyvva..ppeliealrklrsaltlgvsplaqaaaaaaledgelrlerlee
00355891   1/1  rerlrerrdrlaealaelg..levvgpggglflwvdlpdlgldaeelaealleagvlvrpgsaf......
00513231   1/1  ivlrSfSKtfglpGlRvGylva..ppeliealrklksalglgvstlaqaaaaaaledgllglegdeehle
00448071   1/1  lleeglealrarlaeladylaegLeelg.lelvgppgrrsgllvsfdlpdgvdaeelakaLleeygiavs
00502611   1/1  laaldelgvdivlgslsKtlggglrl..Galvg.deeliealrklrhggtftgnplaqaaalaaledlal
00445951   1/1  ylva..ppeliealrklrslgglgvstlaqaaaaaaledglflehleelrarlrerrdllleaLael..g
00497541   1/1  lpGlrlGalvg.deelidalrklrrggtftlsplaqaaalaaledleehleelrerlrelrdrlaeaLee
00474411   1/1  rrarlaeladalragleal.glell..pegrsggvvsfrlpdgidaaalakaleeagiavspgsafl...
00507541   1/1  gaDivtlslhKtlggpkgggGprlGallvrd.elaealplrlggggergfvltldreqairrglagtgna
00520701   1/1  ylaegLael.glpvv..gglgaivlvdlgdgvdakalaaallleaGilvrpgsapav.............
00460561   1/1  vrk.ellerlppllvgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeegleairarl
00389521   1/1  aledggfleehleelrerlrerrdllleaLee.pgl.evlppe...........................
00417041   1/1  iaaaaglaalegleeilerrreladylaeaLkelpglelvgppglsaphlfpvllplpeltelllplggl
00501571   1/1  ivigslsKalggglgl..Gavlgsd.eladalrplrrgltfggnplaaaaalaalelleeeelrerlrel
00375691   1/1  lrsp.lgvstlaqaaaaaaledgllehleelrerlaerrdllleaLeelglvsvvgpsg.glflwvdlpd
00479561   1/1  eelg..lkvlkpsggfflwldlp...........ldaeelaerllee.gvlvrpgsafg...........
00465471   1/1  lgegleairarlleladyllegLkelpglellgppgrrgnivsfrlp.gvdaedlakallekgiavrpgs
00528621   1/1  vapp..elie------------------------------------------------------------
00460871   1/1  GaivtndeelakkarklrfpgegfllgggprqhgiaaaaallalaeleeylerrhenarylaeaLkel.g
00465841   1/1  pllhgggslilvvrfdsltlqelglrfefgtppvaaaaalgaalelleeeglleairerlreladylreg
00423831   1/1  erilelarylaelLeklg.gfellsdgepalpvvafrlkpgdallplldaadlserllerg.....wvvp
00460241   1/1  eehleelrerlrerrdllaealeelpglevv..ppeggfflwvdlpelllktgldaeelaerlleeagva
00533351   1/1  vivlgSfsKalglpGlrv..Galvgpdeellll-------------------------------------
00355861   1/1  yglglalkllkeegglearikrhaeladllydalealglvllvvdpelrspmvvtfrlpdgvdakkflkl
00467471   1/1  lregLeelglpv...gpsdghivlvdl......gdgllakalaeaLlerGilvrpigyptvplg......
00494861   1/1  elaarlreladylaegLaelg..lelvgppganivfvdlp.gvdaeelaaalleagiavspgg.......
00470951   1/1  feagTppvaliaalaaalellleeGleairarhreladalreglealg..lellgpdpaarspgvvsfrl
00357001   1/1  rhaelaallyealdalglvyllvvdpelrsgmvvsftlpdgvlakaflkllkeegiavlkGhrcv.....
00469651   1/1  eelrerlrerrdllleaLaelg...levlppeggfflw.....vdlpelgldaeelaerlleeagvlvr.
00521641   1/1  lgggslyldlkllldyllayqergfeagTppvaliyalgaalellleegleairarhreladalreglea
00500761   1/1  rlggllrqag.llaaaalaalgeegleellaranalarrlaegLaalpglelvgp.petnivffrlpge.
00352461   1/1  grtgslfal-------------------------------------------------------------
00506961   1/1  eehleelrarlrerrdlllealkellppgl..evvppeggfflw.....ldlpegldaeelaeallee.g
00445231   1/1  nvstlaqaaaaaalsdldyleelrerlrerrdllveaLael...glevlppeggfylfldls........
00485711   1/1  ptGvvlppeeylkelrelarkhgillivDeayagfgrtgkpfalellgvddrpdivtlshKalgG.....
00354011   1/1  gelleehleelrerlrerrdllleaLeelg..levlppegglflwvdlpelllklggldaeelaerllee
00461541   1/1  ----------------------------------------------------------------------
00451711   1/1  reewe-----------------------------------------------------------------
00428061   1/1  lelwleeleelrerlaerrdllveaLaelggpgdldvikpqggfflfldlpd............------
00453921   1/1  .eellerlrelgdyllegleelllplvgdvrglGlmlgielvsddgllalalaalllerGvllrpgg...
00358461   1/1  ----------------------------------------------------------------------
00476701   1/1  eglrelierlielarylaegLrelpgfellge.pelglvvfrlkpadalnlalaerllergiavvpgtll
00507681   1/1  allrerrdllleaLeellppgl.kvlppeggfflwldl......pdgldaeelaeallee.gvlvv....
00462551   1/1  errdlllealeellpgllvvkpeggfflwldlpell........lddaefllrllleagva---------
00460891   1/1  rerrdlllealkellpgl.kvlppegafflwldlpel........gldseelaerlleeagvlvvpgsaf
00519931   1/1  ----------------------------------------------------------------------
00503401   1/1  haelakllydaldalglvyllgvdpelrsptvvtfnlpdgvdakdflklldeagiavlkGhrca......
00509771   1/1  ----------------------------------------------------------------------
00428091   1/1  gnplacaaalaalelleeedll.erlaelgarlregleelaahplvgdv..rglglmlgie---------
00450681   1/1  aalsdgellaewleeleemrerlkerrdllveaLrelglpgdlsvikpqggfflwvglpe..........


                         -         -         -         -         *         -         -:420
query           ARDLIADLRQALEG--------------------------------------------------------
00462061   1/1  eraaagiteglvR---------------------------------------------------------
00523021   1/1  dpedakalldalk---------------------------------------------------------
00380341   1/1  vtthaalpleera---------------------------------------------------------
00367801   1/1  altthrqlslelr---------------------------------------------------------
00412601   1/1  thaqlglelraaa---------------------------------------------------------
00511951   1/1  astthlrlglelraa-------------------------------------------------------
00473401   1/1  lelraalgigpgllR-------------------------------------------------------
00405261   1/1  sypglpshpyhel---------------------------------------------------------
00489521   1/1  fgsapslilhpastt-------------------------------------------------------
00517571   1/1  ...........gv---------------------------------------------------------
00487471   1/1  glelllalgisegllr------------------------------------------------------
00461651   1/1  lilhpapsthllalgl------------------------------------------------------
00401341   1/1  vrlgshPavptga---------------------------------------------------------
00408971   1/1  agiavvpgya.pl---------------------------------------------------------
00459731   1/1  legleerlerrrela-------------------------------------------------------
00421441   1/1  vspgsacslgllp---------------------------------------------------------
00393411   1/1  .............---------------------------------------------------------
00527311   1/1  easrdeliealkekg-------------------------------------------------------
00495241   1/1  eladyllegLkel---------------------------------------------------------
00507531   1/1  vstgsfp.....----------------------------------------------------------
00459091   1/1  srdellefllkkgie-------------------------------------------------------
00490701   1/1  arhleladylaeg---------------------------------------------------------
00480741   1/1  akalakalleagiav-------------------------------------------------------
00364061   1/1  dlpgdgidakala---------------------------------------------------------
00440831   1/1  vgghgvfldlell---------------------------------------------------------
00416741   1/1  ............g---------------------------------------------------------
00460071   1/1  .plgegrlRlslglah------------------------------------------------------
00503901   1/1  hleelrarlrerr---------------------------------------------------------
00355891   1/1  ............----------------------------------------------------------
00513231   1/1  elrerlrerrdll---------------------------------------------------------
00448071   1/1  pgsafa...sp..---------------------------------------------------------
00502611   1/1  eehleelrarlrer--------------------------------------------------------
00445951   1/1  lrvlkpeggffl----------------------------------------------------------
00497541   1/1  l.gl.evlvpggglf-------------------------------------------------------
00474411   1/1  ................------------------------------------------------------
00507541   1/1  laiaaaaaalrll---------------------------------------------------------
00520701   1/1  .......plgpg----------------------------------------------------------
00460561   1/1  raladylaegLaa---------------------------------------------------------
00389521   1/1  ....gglflwvdl---------------------------------------------------------
00417041   1/1  llwlfllegidre---------------------------------------------------------
00501571   1/1  adylaegLaelg.---------------------------------------------------------
00375691   1/1  aeelaealleegv---------------------------------------------------------
00479561   1/1  llgegylRlslg----------------------------------------------------------
00465471   1/1  aca....sgllepsl-------------------------------------------------------
00528621   1/1  ----------------------------------------------------------------------
00460871   1/1  ipvv..gptgghl---------------------------------------------------------
00465841   1/1  Leelpglelvg-----------------------------------------------------------
00423831   1/1  ayllptkleg.....-------------------------------------------------------
00460241   1/1  vrpgsaf......---------------------------------------------------------
00533351   1/1  ----------------------------------------------------------------------
00355861   1/1  lkeagi.avlgGhrsl------------------------------------------------------
00467471   1/1  ........psrlR---------------------------------------------------------
00494861   1/1  ..........------------------------------------------------------------
00470951   1/1  pegvdaeellaal---------------------------------------------------------
00357001   1/1  .............---------------------------------------------------------
00469651   1/1  .............---------------------------------------------------------
00521641   1/1  lglellgpdpelr---------------------------------------------------------
00500761   1/1  .llerllergia----------------------------------------------------------
00352461   1/1  ----------------------------------------------------------------------
00506961   1/1  vlvr..........--------------------------------------------------------
00445231   1/1  ..ldaeelaerll---------------------------------------------------------
00485711   1/1  .Gav.gse.elidal-------------------------------------------------------
00354011   1/1  agvlvvpgsaf..---------------------------------------------------------
00461541   1/1  ----------------------------------------------------------------------
00451711   1/1  ----------------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00453921   1/1  .............---------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00476701   1/1  .............---------------------------------------------------------
00507681   1/1  ........pgsaf---------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00460891   1/1  gllgegylR-------------------------------------------------------------
00519931   1/1  ----------------------------------------------------------------------
00503401   1/1  ...............-------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00428091   1/1  ----------------------------------------------------------------------
00450681   1/1  .........-------------------------------------------------------------