[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56680.1


[Show Plain Result]

## Summary of Sequence Search
   1::186
  23::171  1.3e-53 54.4% 0052513 00525131 1/1   like                                    
   1::186


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTWIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
00525131   1/1  ----------------------LvrlrervkeawsqidvqlkrRadlipnlvetvkgyakheketleevt


                         -         -         *         -         -         -         -:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
00525131   1/1  earskaldaedleelaeaenqlssalgrLlavvenyPdLkanenfldlqeelegtenriavarrlYndav


                         +         -         -         -         -         *         -:210
query           SNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGD------------------------
00525131   1/1  teyNtlietFPsnlvaglfgfkekelfeade---------------------------------------