[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56707.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
  24::269  1.2e-31 24.5% 0038453 00384531 1/1   hoenolpyruvate/pyruvate domain          
  24::267    1e-26 23.5% 0047777 00477771 1/1   hoenolpyruvate/pyruvate domain          
  24::266    3e-25 23.6% 0050125 00501251 1/1   hoenolpyruvate/pyruvate domain          
 128::269    2e-07 18.5% 0046414 00464141 1/1   hoenolpyruvate/pyruvate domain          
 128::251  4.1e-07 21.6% 0045708 00457081 1/1   hoenolpyruvate/pyruvate domain          
 128::249  1.3e-06 22.9% 0045706 00457061 1/1   hoenolpyruvate/pyruvate domain          
 128::248  1.4e-06 21.3% 0047978 00479781 1/1   hoenolpyruvate/pyruvate domain          
 128::276  1.6e-06 18.1% 0047484 00474841 1/1   hoenolpyruvate/pyruvate domain          
 128::239  7.1e-05 24.2% 0048777 00487771 1/1   hoenolpyruvate/pyruvate domain          
 128::259  0.00033 22.1% 0049391 00493911 1/1   hoenolpyruvate/pyruvate domain          
 128::187  0.00049 30.5% 0036701 00367011 1/1   hoenolpyruvate/pyruvate domain          
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFT
00384531   1/1  -----------------------iGLlRtEflfleldripseeelilaelkeeredaleklldlqaeaya
00477771   1/1  -----------------------vGLlRtEflflerdrlpavrelilaellegredaldklleeqaeaya
00501251   1/1  -----------------------iGLlRtEflfldrdrlpslvrlmilaedelereaaleklleeqaedy
00464141   1/1  ----------------------------------------------------------------------
00457081   1/1  ----------------------------------------------------------------------
00457061   1/1  ----------------------------------------------------------------------
00479781   1/1  ----------------------------------------------------------------------
00474841   1/1  ----------------------------------------------------------------------
00487771   1/1  ----------------------------------------------------------------------
00493911   1/1  ----------------------------------------------------------------------
00367011   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
00384531   1/1  evleamggkpvtiRtlDigldeflpllggellelaellglsleellkrvelleeenPmLGlRGirlyldy
00477771   1/1  eileamgglpvtiRllDigldeflpllglellelaellglsleellerveelkeeNPmLGlRGirlyldy
00501251   1/1  aeileamaglpvtiRllDigldeflpllglllellelaellglslekllervlelkeeNPmLGlRGirll
00464141   1/1  ---------------------------------------------------------illPfvesaedar
00457081   1/1  ---------------------------------------------------------ialpfvrsaedvr
00457061   1/1  ---------------------------------------------------------valPfvrsaedvr
00479781   1/1  ---------------------------------------------------------valpfvrsaedvr
00474841   1/1  ---------------------------------------------------------ivvPkvesaedar
00487771   1/1  ---------------------------------------------------------valPfvrsaedvr
00493911   1/1  ---------------------------------------------------------ivlPkvesaedvr
00367011   1/1  ---------------------------------------------------------valPfvrsaedvr


                         +         -         -         -         -         *         -:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
00384531   1/1  peifelqlrAllraaalvreelglgnleimiPmvrtveElrlvkelleevglelgeeggvlldlkvgvMi
00477771   1/1  peifelqlrAllraaaegglkeglevnleimlPlvstveElrlvkelleevalelleeglvlldlkvgvm
00501251   1/1  ldypeifelqlrAllrAaaelleegglgnleimiPlvstveElravkelleevglelleeggvlldlkvg
00464141   1/1  avvaalrYpPlGvRgvgpalrallygsladylalaneeilviamIEtaegvenldeIaavpgvdglmiGp
00457081   1/1  evrdllaeagggikiiakIEtpegvenldeIl.easdgimvargDLgv............elgleevpla
00457061   1/1  evvellaeagdgiliiakIEtpegvenldeIl.egvdgvmvgrgDLgv............elgleevpaa
00479781   1/1  elrellkgagggiiiiakiEtaegvenldeIl.eavdgimvargDLgvelgl............eevpla
00474841   1/1  alvaalrYpPlGvRgvgpalralgyglvpldsalldylalaneeilviaqIEtaeglenldeIaavpgvd
00487771   1/1  elrsllryaggeiliiakIEtpeavenldeIl.egvdgvmiGrgDLg....velgvpe........vpla
00493911   1/1  alvallryaeggirlialiEtaeallnleeiaavpgvdglvfGaaDLaadlglr......rtpdhpella
00367011   1/1  evvsllkeagndniliiakIEtpeglenldeIl.egvdgimigrgDL-----------------------


                         -         -         -         +         -         -         -:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRS
00384531   1/1  EvPsaalladelae.evdffsiGtNDLtqytlavdRdnelvalelylekgileadplyd-----------
00477771   1/1  iEvPsaalladelae.evdffSiGtNDLtqytlavdRdnelvflplylelgileeap-------------
00501251   1/1  vmiEvPsaalladelae.evdffsiGtnDLtqytlavdRddelvalllylelgile--------------
00464141   1/1  gDLaaslgl......lgdpdhpevlaaikriiaaaraagkpvgiatq.dledaanavll-----------
00457081   1/1  qkriiaaaraagkpvivatqmlesmiknprPTrAEvsdvan-----------------------------
00457061   1/1  qkriiaaaraagkpviiatqmlesmiknprPtraevsdv-------------------------------
00479781   1/1  qkriiaaaraagkpvivatqmlesmiknprptraevsd--------------------------------
00474841   1/1  glfiGpaDL....saslglplllvlgdpdhpevlaaiarivaaaraagkpagilvvtl.edaaral----
00487771   1/1  qkriiaaaraagkpviiatqmlesmiknp-----------------------------------------
00493911   1/1  arsrivlaaraagla.aidgvfsdiddleglraeaararalGfdgklvi---------------------
00367011   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           THDTARNVE-------------------------------------------------------------
00384531   1/1  ----------------------------------------------------------------------
00477771   1/1  ----------------------------------------------------------------------
00501251   1/1  ----------------------------------------------------------------------
00464141   1/1  ----------------------------------------------------------------------
00457081   1/1  ----------------------------------------------------------------------
00457061   1/1  ----------------------------------------------------------------------
00479781   1/1  ----------------------------------------------------------------------
00474841   1/1  ----------------------------------------------------------------------
00487771   1/1  ----------------------------------------------------------------------
00493911   1/1  ----------------------------------------------------------------------
00367011   1/1  ----------------------------------------------------------------------