[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56712.1


[Show Plain Result]

## Summary of Sequence Search
   1::280
   1::266  1.1e-93 44.9% 0045776 00457761 1/1   )-linked oxidoreductase                 
   3::266    7e-93 44.9% 0046225 00462251 1/1   )-linked oxidoreductase                 
   2::275  5.8e-92 43.8% 0049299 00492991 1/1   )-linked oxidoreductase                 
   1::266  1.3e-91 43.0% 0049058 00490581 1/1   )-linked oxidoreductase                 
   1::275  2.1e-91 43.4% 0046848 00468481 1/1   )-linked oxidoreductase                 
   1::273  5.9e-91 42.6% 0046098 00460981 1/1   )-linked oxidoreductase                 
   3::266  1.9e-89 45.8% 0048892 00488921 1/1   )-linked oxidoreductase                 
   1::266  6.9e-89 44.2% 0047570 00475701 1/1   )-linked oxidoreductase                 
   1::273  3.6e-88 44.9% 0051795 00517951 1/1   )-linked oxidoreductase                 
   3::266  8.3e-88 45.8% 0045771 00457711 1/1   )-linked oxidoreductase                 
   1::266  4.5e-87 45.3% 0049985 00499851 1/1   )-linked oxidoreductase                 
   3::266  1.9e-86 47.4% 0050262 00502621 1/1   )-linked oxidoreductase                 
   3::275  2.8e-86 43.6% 0047367 00473671 1/1   )-linked oxidoreductase                 
   3::281    8e-84 41.4% 0048247 00482471 1/1   )-linked oxidoreductase                 
   1::269  5.1e-83 42.1% 0048846 00488461 1/1   )-linked oxidoreductase                 
   1::275  7.5e-83 39.1% 0048014 00480141 1/1   )-linked oxidoreductase                 
   3::273  1.7e-82 39.3% 0048562 00485621 1/1   )-linked oxidoreductase                 
   3::268    8e-82 42.8% 0047249 00472491 1/1   )-linked oxidoreductase                 
  11::279    2e-80 38.1% 0047069 00470691 1/1   )-linked oxidoreductase                 
   1::270  6.5e-80 38.9% 0048842 00488421 1/1   )-linked oxidoreductase                 
   3::273    8e-79 37.8% 0046647 00466471 1/1   )-linked oxidoreductase                 
   1::280


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
00457761   1/1  eyrvlgntglkvpalglGtmrlgg.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00462251   1/1  --meyrvlgntglkvpalglGtmrlgg.eeaiaavraaldaGinhiDtAdvYgsEelvGealkelleegl
00492991   1/1  -yrrlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkellkesgv
00490581   1/1  eyrrlgntglkvsalglGtmrlgd.eeaiaalraaldaGinfiDtAdvYgsEelvGealkellkesgvpr
00468481   1/1  eyrvlgntglkvpalglGtmrlgd.eeavaavkaaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00460981   1/1  eyrvlgntglkvpalglGtmrlgg.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvkR
00488921   1/1  --llmeyrvlgntglkvpalglGtmrlggldeeeavaavraaldaGinhiDtAdvYgsEelvGealkell
00475701   1/1  meyrvlgntglkvsalglGtmrlgg.eeaiaavraaldaGinfiDtAdvYgsEelvGealkellkesgvk
00517951   1/1  meyrvlgntglkvpalglGtmrlgg.eeaiaavraaldaGinhiDtAdvYgsEelvGealkellkeglgv
00457711   1/1  --lllmeyrvlgntglkvpalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkel
00499851   1/1  meyrvlgntglkvpalglGtmrlgd.eealaavraaldaGinhiDtAdvYgsEelvGealkellkesgvk
00502621   1/1  --meyrvlgntglkvsalglGtmrlgg.eealaavraaldaGinliDtAdvYgsEelvGealkellkesg
00473671   1/1  --lmeyrvlgntglkvsalglGtmrlggldeeeaiaavraaldaGinhiDtAdvYgsEelvGealkellk
00482471   1/1  --lmeyrvlgntglkvsalglGtmrlgg.eealallraaldaGinliDtAdvYgsEellGealkelgvpr
00488461   1/1  meyrklgntglkvsalglGtmtlgglyggqvdeeealalldaaldaGinfiDtAdvYgnglsEellGeal
00480141   1/1  meyrrlgntglkvsalglGtmtlggqldeeeaiaaldaaldaGinfiDtAdvYgvplsaellglsEellG
00485621   1/1  --lmeyrllgntglkvsalglGtmtlgglyldeeeaialldaaldlGinfiDtAdvYgnglsEellgeal
00472491   1/1  --meyrllgntglkvsalglGtmrlgg.eealallraaldaGinliDtAdvYgsEellGealkelgvpre
00470691   1/1  ----------kvsalglGtmtlggaldeeeaialldaaldaGinfiDtAdvYgdglsEellGealkelgv
00488421   1/1  eyrrlgnsglkvsalglGtmtlgglyllgaldeeealalldaaldaGinfiDtAdvYgdglsEellGeal
00466471   1/1  --lmeyrrlgnsglkvsalglGtmtlgggqldeeealalldaaldaGinfiDtAdvYgdglsEellGeal


                         -         -         *         -         -         -         -:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
00457761   1/1  edlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllslvplee
00462251   1/1  gvpRedlfiatKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllv
00492991   1/1  kRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllvpl
00490581   1/1  edlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpvalkllelldplvpleetlealeelvk
00468481   1/1  edlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedgllllllvplee
00460981   1/1  edlfiaTKlgptdlsrehvraaleeslkrLgtdyiDlyliHwpdplklldlllpldedgllllllvplee
00488921   1/1  kesgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllll
00475701   1/1  RedlfiatKlgltdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllallllllldedgllll
00517951   1/1  pRedlfiatKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllslvpl
00457711   1/1  lkesgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglll
00499851   1/1  RedlfiaTKlgltdlsrehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedgllllllvple
00502621   1/1  vpredlfiaTKlgltdlspehvraaleeslkrLgtdyiDlyllHwpdp.ple..........etlealee
00473671   1/1  esgvkRedlfiaTKlgptdlspehvraaleeslkrLgtdyiDlyllHwpdplklldlllpldedglllll
00482471   1/1  edlfiaTKlg..dlspehvraaleeslkrLgtdyiDlyllHwp........dpllvpleetlealeelvk
00488461   1/1  kelgk.rddlviaTKvgptlgdgvnlldlspehiraaleeslkrLgtdyiDlyllHrpdpltple.....
00480141   1/1  ealkelg.pRddlviaTKvgitlgdgpnllvllldlsrehiraaleaslkrLgtdyiDlyllHwpdalkl
00485621   1/1  kdlgvkRddlfiaTKvgillgdgpnllvllldlspehiraaleesLkrLgtdyiDlyllHrp........
00472491   1/1  dlfiaTKlgltdlspehvraaleeslkrLgtdyiDlyllhwp........dpllvpleetlealeelvke
00470691   1/1  prddlviaTKvglrnglglsrehiraaleasLkrLgtdyiDlyllHrp.........dpltpleetleal
00488421   1/1  k..gvprddlviatKvglllldgpnlldlsrehiraaleeslkrLgtdyiDlyllHrp.........dpl
00466471   1/1  kelgvprddlviaTKvgilllglnlldlsrehiraaleaslkrLgtdyiDlyllHrp.........dplt


                         +         -         -         -         -         *         -:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
00457761   1/1  tlealeelvkeGkvraiGvSnfsaeqleellelaeglvppavnqveynlllrelellelckelgigvlay
00462251   1/1  pleetlealeelvkeGkvraiGvSnfsaeqleellavakippavnqveynlllrelellelcrelgigvl
00492991   1/1  eetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelcrelgigvl
00490581   1/1  eGkvraiGvSnfsaeqleellalaevppavnqveynlllrerellelcrelgigvlaysPlggGlltgky
00468481   1/1  tlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllrelellelckelgigvlay
00460981   1/1  tlealeelvkeGkvraiGvSnfsaeqleellalaeglippvvnqveynlllrelellelckelgigvlay
00488921   1/1  llvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrerellelcrel
00475701   1/1  slvpleetlealeelvkeGkvraiGvSnfsaeqleellalakippavnqveynlllrelellelckelgi
00517951   1/1  eetlealeelvkeGkvraiGvSnfsaeqleellavakippavnqveynlllrelellelcrelgigvlay
00457711   1/1  lsltpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelcke
00499851   1/1  etlealeelvkeGkvraiGvSnfsaeqleellelaeglippavnqveynlllrelellelckelgigvla
00502621   1/1  lvkeGkvraiGvSnfsaeqleellelaeippavnqveynlllrelellelcrelgigvlaysPlgggllt
00473671   1/1  lvpleetlealeelvkeGkvraiGvSnfsaeqleellelaeglippvvnqveynlllrelellelcrelg
00482471   1/1  eGkvraiGvSnfsaeqleellelapivpvqnqynllprlaerellelcrelgigvlaysPlggglllgky
00488461   1/1  ....etlealeelvkeGkiryiGvSnfsaeqleealelak..pvvvQveynlllrqaerellplcrelgi
00480141   1/1  ldgllllllllllpltpleetlealeelvkeGkvryiGvSnfsaeqleealevaellglippvvnqveyn
00485621   1/1  .dpltpleetlealeelvkeGkvryiGvSnfsaeqleealalagvppvvnqqelyplllreaelellplc
00472491   1/1  GkvraiGvSnfsaeqleellelapivpvqnqynllprlaerellelcrelgigvlaysPlggglllgkyd
00470691   1/1  eelvkeGkvryiGvSnfsaeqleealavaeklglvppvvnqveynlllrqaerellplcrelgigvvays
00488421   1/1  tpleetlealeelvkeGkvryiGvSnfsaeqleealav..vppvvvqveynlllrqaerellplcrelgi
00466471   1/1  pleetlealeelvkeGkvryiGvSnfsaeqleealavaellglvppvvvqveynlllrqalelellplcr


                         -         -         -         +         -         -         -:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
00457761   1/1  sPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvvvipgsss--------------
00462251   1/1  aysPlggglltgkyldgallledevlkeiakkhgvtpaqvalawllqrgvvvipga--------------
00492991   1/1  aysPlggglltgkylpgapllllvevlkeiakkhgvtpaqvalawllqrpvvvipgassperlee-----
00490581   1/1  lsgllfllelleallllvevlkeiakkhgvtpaqvalawllqrpvvvipgassper--------------
00468481   1/1  sPlggglltgkyldgpllllvpvlkeiakkhgvtpaqvalawllqrgvvvipgasnperleenla-----
00460981   1/1  sPlggglltgkyldgalllllpvlkeiaekhgvtpaqvalawllqrgvvvipgasnperleen-------
00488921   1/1  gigvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpv--------------
00475701   1/1  gvlaysPlggglltgkylggalpeallllvevlkeiakkhgvtpaqvalawllqrg--------------
00517951   1/1  sPlggglltgkyldgallledevlkeiaekhgvtpaqvalawllqrgvvvipgasnperleen-------
00457711   1/1  lgigvlaysPlggglltgkylsgapllllvevlkeiakkhgvtpaqvalawllqrg--------------
00499851   1/1  ysPlggglltgkyldgaalllvpvlkeiakkhgvtpaqvalawllqrgvvvipgss--------------
00502621   1/1  gkydevlkeiaeklgvspaqvalawllqrgvvvipgassperleenlaaldfelse--------------
00473671   1/1  igvlaysPlggglltgkylpgapllllvevlkeiakkhgvspaqvalawllqrpvvvipgasnpe-----
00482471   1/1  devlkeiaeklgvspaqvalawllqrgvvvipgassperleenlaaldfelseeelaaldellrglrvvg
00488461   1/1  gvlaysPlagGlLtgkyldgalpdsgdlrsllplfldelleellelvealeeiaklkhg-----------
00480141   1/1  lllrqaerellplcrelgigvlaysPlagGlLtgkylsgalpdgdlrrllprflrelleallllv-----
00485621   1/1  relgigvlaysPlagglltgkylsgllllevlkeiakkhgvtpaqvalawllqrpavtvvipg-------
00472491   1/1  evlkeiaeklgvspaqvalawllqrpavvipgassperleenlaaldlelsdeelaal------------
00470691   1/1  PlagGlLtgkylsgallasgdlrlllasllllllllprflrelleallllvealaeiaeklgvspaqva-
00488421   1/1  gvvaysPlagGlltgkylsgallasgdlrlllprflrelleallllvealkeiaekhgvt----------
00466471   1/1  elgigvvaysPlagGlLtgkyldglllasgrllldlrlllprflgelleallllvealaeiak-------