[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56832.1


[Show Plain Result]

## Summary of Sequence Search
   1::328
  88::253  2.4e-34 32.3% 0042691 00426911 1/1   nese/Cell cycle control phosphatase     
 110::241  1.4e-29 32.6% 0046064 00460641 1/1   nese/Cell cycle control phosphatase     
  96::232  2.6e-27 27.9% 0043033 00430331 1/1   nese/Cell cycle control phosphatase     
 109::218  2.1e-23 32.1% 0049169 00491691 1/1   nese/Cell cycle control phosphatase     
 107::225  3.1e-22 29.7% 0046433 00464331 1/1   nese/Cell cycle control phosphatase     
 111::234  2.1e-21 30.0% 0049168 00491681 1/1   nese/Cell cycle control phosphatase     
 111::218  4.6e-21 32.7% 0044085 00440851 1/1   nese/Cell cycle control phosphatase     
 114::218  6.8e-21 34.3% 0038171 00381711 1/1   nese/Cell cycle control phosphatase     
 110::218  1.2e-20 28.4% 0046432 00464321 1/1   nese/Cell cycle control phosphatase     
 116::218  6.3e-20 34.3% 0049979 00499791 1/1   nese/Cell cycle control phosphatase     
  96::215  5.7e-19 28.7% 0051401 00514011 1/1   nese/Cell cycle control phosphatase     
 112::218  1.4e-18 31.8% 0044241 00442411 1/1   nese/Cell cycle control phosphatase     
 111::215  3.6e-18 33.0% 0043853 00438531 1/1   nese/Cell cycle control phosphatase     
 114::215  1.4e-17 34.4% 0051400 00514001 1/1   nese/Cell cycle control phosphatase     
  95::215  2.3e-16 28.2% 0051398 00513981 1/1   nese/Cell cycle control phosphatase     
 114::217  5.3e-16 30.8% 0049841 00498411 1/1   nese/Cell cycle control phosphatase     
 117::220  1.3e-14 30.0% 0051399 00513991 1/1   nese/Cell cycle control phosphatase     
 119::218  2.1e-14 33.3% 0038810 00388101 1/1   nese/Cell cycle control phosphatase     
 115::215  2.8e-14 31.7% 0049980 00499801 1/1   nese/Cell cycle control phosphatase     
 118::237  7.7e-11 28.2% 0050551 00505511 1/1   nese/Cell cycle control phosphatase     
 122::217  1.4e-10 30.2% 0041897 00418971 1/1   nese/Cell cycle control phosphatase     
 111::237  4.1e-08 25.0% 0041896 00418961 1/1   nese/Cell cycle control phosphatase     
   1::328


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
00426911   1/1  -----------------mlvllikdllvllllllvspl.....lsglkyispeelkallesglsslledv
00460641   1/1  ---------------------------------------llllllvlllllllvlallagvklispeela
00430331   1/1  -------------------------vilvlllvgglaawlaaalpvvklispeelaellddgpdvvllDv
00491691   1/1  --------------------------------------alvlaalnvvllispeelkellddgdvvliDv
00464331   1/1  ------------------------------------sglltallsvvplispeelaallddgdvvllDvR
00491681   1/1  ----------------------------------------lpellpgplispeelaelldsglldpdvvl
00440851   1/1  ----------------------------------------lpllsvvklispeelaellddg.vvllDvR
00381711   1/1  -------------------------------------------lsvvklispeelaellddgdavllDvR
00464321   1/1  ---------------------------------------ftalldpvllvsaeelaallddgdvvllDvR
00499791   1/1  ---------------------------------------------tvklispeellellddgdvvliDvR
00514011   1/1  -------------------------llllllvlllllllllaalaavplisaeelaallddgdedvvllD
00442411   1/1  -----------------------------------------llanlvllvsaeellallddgdvvllDvr
00438531   1/1  ----------------------------------------iealssvklisaeelaellddgdvvlvDvR
00514001   1/1  -------------------------------------------lssvplispaelaelladgdvvllDvr
00513981   1/1  ------------------------lllalllvvplyfallaellagvptisaeelaallddgedavllDv
00498411   1/1  -------------------------------------------lnpsllvsaeellellddgdvvllDvR
00513991   1/1  ----------------------------------------------vplisaeelaallddgedvvllDv
00388101   1/1  ------------------------------------------------pllalalvvallddvklispee
00499801   1/1  --------------------------------------------lpsllvsaeellellddgdvvllDvr
00505511   1/1  -----------------------------------------------llalivavaalagvplisaeeLk
00418971   1/1  ---------------------------------------------------aeellallddpdvvllDvr
00418961   1/1  ----------------------------------------vvkmsllllvsaeelaall.d.dvvlvDar


                         +         -         -         -         -         *         -:210
query           NDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
00426911   1/1  vliDvRspeeyeggHipgAiniplsellerelletllalleldkdkpivvyCefsgvrsakaaalLreld
00460641   1/1  ellddglsdlledvvliDvRspeeyeggHipGAinipldellerllelllallgldkdkpvvvyCefsgv
00430331   1/1  RepeeyaaghipgAvniplgeleeflaelaalgid.kdkpvvvycrsgvrsaraalllrelGfenvynld
00491691   1/1  RspeeflglvpeprleelaaghipgAinipldelldddgtlpspeeleellselgid.kdkpivvyCgsg
00464331   1/1  spaefageglldlraghipgAinipldtlldgdglllspeelaellael.gldkdkpvvvycrsgvrsar
00491681   1/1  lDvRsadrflgeepaeyaaghipgAvnipldtlldpdgplphllpspeelaellael.gidkdkpvvvyc
00440851   1/1  epeeyagghipgAvniplgellerglllspeeleallggldkdkpvvvycrsgvrsaraalllrelGfen
00381711   1/1  epeeyaaghipgAvnipldeleerlgel......dkdkpvvvycrsgvrsalaalllrelGfenvyvldg
00464321   1/1  spaeyagghipgAvnlpldelldrldelpgtlpspeelaallgalgidkdkpvvvydcgsgvraaraawl
00499791   1/1  salrdflglpepeeyaaghipgAinipldelldadgplphmlpsaeeleellael.gidkdkpivvyCgs
00514011   1/1  vRepeeyaaghipgAvniplgelearlgelgidk....dkpivvycrsgvrsalaaalLrelGf.nvynl
00442411   1/1  epeelyagghIpgAvnipldalldddgrhtlpspeelaallgelgidkdkpvvvycgsglvrAaraawal
00438531   1/1  epeeyagghipgAinipldeleerlgellp..gidkdkpvvvycgsgvrsgpklarllraraalalralG
00514001   1/1  epaeyaaghipgAvnlpldella......rllgldkdkpvvvycgsgvraaraawllralGfdnvyvLdG
00513981   1/1  Repeefaaghipgainiplgelear....laellpdkdkpivvycasgvrsalaaalLrkaGfdnlvynl
00498411   1/1  speeflgevllldpglglaayaaghipgAvnipldelldadgtlpspeelaellaelgidkdkpvvvycg
00513991   1/1  Repeefaaghipgavnipldelearlael....gidkdkpvvvycgsgvrsaraalllralGyenvyvld
00388101   1/1  llellesggedvlllDvRppeeYeggHIpgAiniplpelllrrlkfdllllllllspeeleell...lgl
00499801   1/1  speeflgeveelraalraghipgAvnipldellddgtlpspeelaallaelgidkdkpvvvycgsgvraa
00505511   1/1  allddpndsvlllDvRspdeyekghIpgAvniplsqlllrrsdgtleslleleellallgidkdkpvvly
00418971   1/1  saleflgeveegrplyraghIpgAvnipldellddsdldgtlpspeelaellgalgidndeeadlkpvvv
00418961   1/1  salrflgegpaeyraghIpgAvnlpldellddlllsspldgtlpspeelaallgelgidkdkpvvvycgs


                         -         -         -         +         -         -         -:280
query           GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
00426911   1/1  ralnlypklGytnvyvLdGGykaWraa...glplcegksyvpd---------------------------
00460641   1/1  rsakaarlLrkllralnlypllGypnvyvLd---------------------------------------
00430331   1/1  gGilaWlaaglpvesgldgelf------------------------------------------------
00491691   1/1  vrsaraal--------------------------------------------------------------
00464331   1/1  aalllrelGfenvyv-------------------------------------------------------
00491681   1/1  rsslgvrlaaraalllralGfenv----------------------------------------------
00440851   1/1  vylldGGl--------------------------------------------------------------
00381711   1/1  GilaWlaa--------------------------------------------------------------
00464321   1/1  lrllGfen--------------------------------------------------------------
00499791   1/1  gvrssara--------------------------------------------------------------
00514011   1/1  dGGil-----------------------------------------------------------------
00442411   1/1  rllGyknv--------------------------------------------------------------
00438531   1/1  yknvy-----------------------------------------------------------------
00514001   1/1  GlaaW-----------------------------------------------------------------
00513981   1/1  eGGil-----------------------------------------------------------------
00498411   1/1  sgvrsal---------------------------------------------------------------
00513991   1/1  gGlsaWlaag------------------------------------------------------------
00388101   1/1  dkdkpvvv--------------------------------------------------------------
00499801   1/1  raala-----------------------------------------------------------------
00505511   1/1  cgsgvraalaldstlrllalalkllgy-------------------------------------------
00418971   1/1  ycgsgvr---------------------------------------------------------------
00418961   1/1  gglvrAaraawalrllGh.dvyvLdGG-------------------------------------------


                         -         *         -         -         -         -         +:350
query           EDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV----------------------
00426911   1/1  ----------------------------------------------------------------------
00460641   1/1  ----------------------------------------------------------------------
00430331   1/1  ----------------------------------------------------------------------
00491691   1/1  ----------------------------------------------------------------------
00464331   1/1  ----------------------------------------------------------------------
00491681   1/1  ----------------------------------------------------------------------
00440851   1/1  ----------------------------------------------------------------------
00381711   1/1  ----------------------------------------------------------------------
00464321   1/1  ----------------------------------------------------------------------
00499791   1/1  ----------------------------------------------------------------------
00514011   1/1  ----------------------------------------------------------------------
00442411   1/1  ----------------------------------------------------------------------
00438531   1/1  ----------------------------------------------------------------------
00514001   1/1  ----------------------------------------------------------------------
00513981   1/1  ----------------------------------------------------------------------
00498411   1/1  ----------------------------------------------------------------------
00513991   1/1  ----------------------------------------------------------------------
00388101   1/1  ----------------------------------------------------------------------
00499801   1/1  ----------------------------------------------------------------------
00505511   1/1  ----------------------------------------------------------------------
00418971   1/1  ----------------------------------------------------------------------
00418961   1/1  ----------------------------------------------------------------------