[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for spne4:ACF56852.1


[Show Plain Result]

## Summary of Sequence Search
   1::156
   1::74   1.7e-17 39.2% 0045802 00458021 1/1   ed helix" DNA-binding domain            
   4::78   3.1e-17 38.7% 0037456 00374561 1/1   ed helix" DNA-binding domain            
  79::149    6e-17 31.0% 0035348 00353481 1/1   minal domain of arginine repressor      
  79::149  7.5e-17 31.0% 0037457 00374571 1/1   minal domain of arginine repressor      
  80::149  1.4e-16 31.4% 0045063 00450631 1/1   minal domain of arginine repressor      
   5::78   1.9e-16 41.9% 0035347 00353471 1/1   ed helix" DNA-binding domain            
   1::156


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSIS
00458021   1/1  llllmkkearlalikelikeesigtQeeLvelLkeeGiedvtqatvsRdlkelglvkvrnakgelvYllp
00374561   1/1  ---KeeRqalIlellkekgivtqeeLaellkeegfdvsqatisRdlkelglvkvrsengeyvyalpeelg
00353481   1/1  ----------------------------------------------------------------------
00374571   1/1  ----------------------------------------------------------------------
00450631   1/1  ----------------------------------------------------------------------
00353471   1/1  ----aeRqalIlellkeneiltqeelaelLkeeginvsqatisrdlkelglvkvrsgdgevvyalpeelg


                         -         -         *         -         -         -         -:140
query           KWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
00458021   1/1  eelg------------------------------------------------------------------
00374561   1/1  vpilkklr--------------------------------------------------------------
00353481   1/1  --------llkdlvlsvelvenlvvlktlpGnAqllaslldelgldeilgtiaGddtilviarseeaaee
00374571   1/1  --------llkdlvlsvelvenlvvlktlpGnAqllaslldelgldeilgtiaGddtilviarseeaaee
00450631   1/1  ---------lkdlvlsvdavenlvvlktlpGnAqllaslldslgldegilgtiaGddtvlvilrseeaae
00353471   1/1  vntlkrlr--------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CFEELKKFAPPFFFEE------------------------------------------------------
00458021   1/1  ----------------------------------------------------------------------
00374561   1/1  ----------------------------------------------------------------------
00353481   1/1  llelllell-------------------------------------------------------------
00374571   1/1  llelllell-------------------------------------------------------------
00450631   1/1  ellelllel-------------------------------------------------------------
00353471   1/1  ----------------------------------------------------------------------