[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54134.1


[Show Plain Result]

## Summary of Sequence Search
   1::267
   7::263  PF02567 0.0% 42.8015564202335  Phenazine biosynthesis-like protein 
   1::267


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
PF02567         ------vdaFtekpfkGNpaaVvldadelddeemqkiAaefnlSETaFvlppsdekarfrlRiFTpvaEv


                         -         -         *         -         -         -         -:140
query           DLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
PF02567         plcGHatlatahvLfeeglvenktleletkaGilpvkslkekdkgeelavelnfPefdleevssedtaal


                         +         -         -         -         -         *         -:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
PF02567         lellasefiealpiavkstglekvvvplkskealealkpdlsdaikkcpkngvivtaaasagskrdfasR


                         -         -         -         +         -         -         -:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRY-------------
PF02567         mFaPklGivEDpvtGsAacalgaylskklnkktaeikieqgkasgrsgtlele-----------------