[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54138.1


[Show Plain Result]

## Summary of Sequence Search
   1::777
   9::199  PF09371 0.0% 60.2094240837696  Tex-like protein N-terminal domain 
 649::721  PF00575 0.0% 47.9452054794521  S1 RNA binding domain 
 140::195  PF03934 0.0% 22.2222222222222  General secretion pathway protein K 
 495::544  PF03934 0.0% 28.5714285714286  General secretion pathway protein K 
   1::777


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIEERLRYLRELEERRT
PF09371         --------iakelklkekqveavieLldegatvPFIaRYRkeatggLdevqlreleerleylrelekrke
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
PF09371         tilksieeqgklteeLkkkiekaetlteledlYlPykkkrrTkAqiAreaGLeplAelllaqeeedleee
PF00575         ----------------------------------------------------------------------
PF03934         ---------------------------------------------------------------------r
PF03934         ---------------------------------------------------------------------r


                         +         -         -         -         -         *         -:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
PF09371         akkyvneekgvkdveealegardIlaeeisedaelrkklrelllkkgeleskvkkgkee-----------
PF00575         ----------------------------------------------------------------------
PF03934         tenlrarqQaqwyalgaealarqiLredaredkkd.vdhlgep.Waqplaefpld---------------
PF03934         tenlrarqQaqwyalgaealarqiLredaredkkd.vdhlgep.Waqplaefpld---------------


                         -         -         -         +         -         -         -:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLEPEEPAEDPRARSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMVSEAG
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ASVYSASAYASQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----tkiNiNtasaevLaAlveglslsqaqrllaaRpea.gfrsvadflaasal----------------
PF03934         ----tkiNiNtasaevLaAlveglslsqaqrllaaRpea.gfrsvadflaasal----------------


                         -         -         -         *         -         -         -:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNVAAFGAFVDVGVHHDGLVHVSAMSKSFVKDPRDVVKPGD
PF09371         ----------------------------------------------------------------------
PF00575         ------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgd
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           IVRVKVLDVDVRRKRISLTLRLDDEVDQRSGENNRSGGERRERGAPRRGDQRRQRGGRGEQQPMGAMAEA
PF09371         ----------------------------------------------------------------------
PF00575         evevkvlkvdkerkriiLsik-------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LRRAGLV---------------------------------------------------------------
PF09371         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------
PF03934         ----------------------------------------------------------------------