[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tfus0:AAZ54145.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
  55::101  PF00149 0.0% 29.7872340425532  Calcineurin-like phosphoesterase 
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNTTGRVLRRIGTAAAVTGALGVAGLVYASVVERNWFRLRHYEIPILAPGSDRLRILHLSDAHLTPGRR
PF00149         ------------------------------------------------------lrilvigDlHgglddl


                         -         -         *         -         -         -         -:140
query           LLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSS
PF00149         etlllilleiaaeekpdlvlflGDlvdrgdw---------------------------------------


                         +         -         -         -         -         *         -:210
query           KADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTAD
PF00149         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGG
PF00149         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LGTSPYAPVRFCCRPEAALLDLIPRA--------------------------------------------
PF00149         ----------------------------------------------------------------------